(data stored in ACNUC7421 zone)

EMBL: CP001622.PE484

CP001622.PE484       Location/Qualifiers
FT   CDS_pept        512535..513692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0490"
FT                   /product="Adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="PFAM: S-adenosyl-L-homocysteine hydrolase, NAD
FT                   binding; KEGG: ahcY; adenosylhomocysteinase protein; K01251
FT                   adenosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54796"
FT                   /db_xref="GOA:C6B2H6"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H6"
FT                   /inference="protein motif:PRIAM:3.3.1.1"
FT                   /protein_id="ACS54796.1"
FT                   /translation="MEKSATRIDWIGNSCRLLKATAAEFERTRPFEGLSIGTGIHLEPK
FT                   TVALLTTLRAGGARLVCTGNLNSTQPSTVEFLRTQGISVFATQTTDPAAHHQSLEAVIA
FT                   EKPNLLLDNGGDLFAIAAEKPYANLRGGTEETTSGRIRLLPLRARLNMPILVINDSPIK
FT                   QFAENRHAVGQSLFESYLRFTNRSTNGKRVTVFGYGACGKGTAACFRNAFSTVSVIDID
FT                   PVTTLEAHLDGFTTPLRDAAIRSADIIVTVTGFAGIVTAADLPLVKDGAILMNGGHFPH
FT                   EIDVEAFRRHPDVIGIDRYEADHIETFHLSDGRSFHLLGGGHMANLAGPRPLGNTVESM
FT                   DLGFTLQARCLERIAKGEAGPQSCVVPVPADIDAMVANAYLDLAR"
     atggaaaaga gcgcaacccg catcgactgg atcggcaaca gctgccggct gctcaaggcg        60
     acggcggccg aattcgagcg gacgcgtccc ttcgagggcc tgtcgatcgg caccggcatc       120
     catctggagc cgaagacggt ggcgctgctg acgacgcttc gcgccggtgg ggcgcgtctt       180
     gtctgcaccg gcaatctcaa cagcacccag ccttcgacgg tcgagttctt gcgtacccaa       240
     ggcatctcgg tcttcgcgac gcagacgacc gatcccgccg ctcaccatca gagcctcgaa       300
     gcggtgattg ccgaaaagcc gaatctgctg ctcgacaatg gcggcgatct tttcgccatc       360
     gcggcggaaa aaccctacgc caatctccgc ggcggcacag aggaaaccac ctcgggccgc       420
     atccgcctgc tgccgctgcg cgcgcgcctg aacatgccga tcctcgtcat caacgacagc       480
     ccgatcaagc agttcgccga aaacaggcat gccgtcggtc agagcctgtt cgaaagctac       540
     ctgcgcttca ccaaccgctc caccaacggc aagcgcgtga cggtgttcgg ctacggcgcc       600
     tgcggcaagg gcacggccgc ctgtttccgc aatgcctttt ccaccgtcag cgtcatcgat       660
     atcgatccgg tgacgacgct cgaagctcat ctcgacggtt tcaccacacc gctgcgcgac       720
     gcggcgatcc gctcggccga tatcatcgtt accgtcacgg gttttgccgg catcgtgacg       780
     gcggccgacc tgccgctcgt caaggatggc gcgatcctga tgaatggcgg ccatttcccg       840
     catgagatcg atgtcgaagc cttccgtcgc caccccgatg tcattggcat cgatcgctac       900
     gaggccgacc atatcgagac cttccatctc agcgacggcc gctctttcca tctgctcggt       960
     ggcggccata tggccaatct cgccggcccg cggccgctcg gcaataccgt cgagtcgatg      1020
     gatctcggct tcacccttca ggcccgctgc ctggaacgca tcgccaaggg cgaggccggc      1080
     ccccaatcct gcgtcgtgcc tgtgcccgcg gatatcgatg ccatggtggc gaacgcctac      1140
     ctcgatctgg cgcgttaa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page