(data stored in ACNUC7421 zone)

EMBL: CP001622.PE485

CP001622.PE485       Location/Qualifiers
FT   CDS_pept        complement(513711..514706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0491"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   met:M446_1258 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54797"
FT                   /db_xref="GOA:C6B2H7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H7"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACS54797.1"
FT                   /translation="MSVQSTMKALLAEAPNSPLRIADISKPVPGEGQVLVRIKASGVNP
FT                   LDLKIRAGNAAHARHPLPAIVGIDMAGVVEEVGTGVSGFRRGDAVYGMTGGVGGIQGSL
FT                   AEFAAVDAALLAPKPQNLSMREAAALPLISITAWEGLVDRAGVKAGQKVLVIGGGGVGH
FT                   IVAQIAKAAGAEVYVVDGTSKADYLAGLGATPIDRDAETVETYVARHTGGKGFELVYDT
FT                   VGGQGLDTAFRAVSQFGHVVSCLGWGSHALAPLSFKAATYSGVFTLLPLLTGEGRAHHG
FT                   EIMREMTKLAEAGKVMPKLDPRRFTLADTDEAHRLIENRQADGKLVVEID"
     atgtctgtac aatcaacgat gaaagcgctg ttggctgaag caccgaattc accattgcgc        60
     atcgccgata tttcaaaacc ggtgcccggc gaaggccagg tccttgtgcg catcaaggca       120
     agcggcgtca atccgctcga cctcaagatc cgggccggca atgcggccca tgcccgccat       180
     ccgcttcccg ccattgtcgg tatcgatatg gccggtgttg tcgaagaggt cggaactggc       240
     gtcagcggtt ttcgccgcgg cgacgcggtc tacggcatga ccggcggggt cggcggcatt       300
     cagggatcgc ttgccgaatt tgcagctgtt gacgccgcgc tgctggcgcc aaagccgcag       360
     aatctgtcga tgcgcgaggc agccgccttg ccgctgatct cgatcaccgc ctgggagggg       420
     ctggtcgacc gcgccggggt caaggccggc cagaaggttc tggtgattgg cggcggcggt       480
     gtcggccata tcgtcgcgca gatcgccaag gctgccggag ccgaggtcta tgtggtcgac       540
     ggcacgtcga aagcagacta tctcgccggc cttggcgcaa cgccgatcga tcgtgacgcg       600
     gaaacggtgg aaacctatgt cgcaagacac accggcggca agggtttcga actggtctac       660
     gataccgtcg gcggccaggg gctcgatacg gcattccgag ccgtcagcca gttcggccac       720
     gtcgtcagct gccttggctg gggaagccac gcgctggcac cgctctcctt caaggccgcc       780
     acctattcag gcgtcttcac gctgctgccg ctgctgaccg gcgaaggacg cgcccatcat       840
     ggtgagatca tgcgagagat gacgaagctt gccgaagccg gcaaggtgat gccgaagctc       900
     gacccgcgcc gcttcaccct tgccgataca gatgaggcgc atcggctgat cgaaaaccgg       960
     caggcggacg ggaagctcgt cgtcgagatc gactga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page