(data stored in ACNUC7421 zone)

EMBL: CP001622.PE486

CP001622.PE486       Location/Qualifiers
FT   CDS_pept        514845..515696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0492"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mms:mma_1919 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54798"
FT                   /db_xref="GOA:C6B2H8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54798.1"
FT                   /translation="MEWSDLKLFLAIARFGTLGAAARRLGLTQPTMGRRLRALEASLGQ
FT                   TLFQRTTDGFVLTDEGAAVFAGAERIEEEALAMERSLAGGSRQLDGLLRLSSSDWFGAH
FT                   VLSPVLAEFSQVHPKVVVELLTDSRLLSLSRREADLVFRIQPFTEAEIVSRKLIRIEYG
FT                   LYISRGAPHPEAGDGAGARLVTMDEAFGEMPDVGWLRRLLPQADIVTRSNSRDVQAALC
FT                   ANGAGLAVLPRPLGDSLAAIELVDLGEPPPGRDTWVGYHRDMKRLARLRALLDLVIERL
FT                   AR"
     atggaatgga gtgacctcaa gctgtttctg gcgatcgcgc ggttcggcac gctgggggca        60
     gcagcccgcc gcctcggact gacgcagccg acgatgggca ggcggctgcg tgcccttgaa       120
     gcctctctcg gccagacgct ttttcagcgc acgaccgatg gcttcgtcct gaccgacgaa       180
     ggcgcagccg tgttcgccgg cgccgaacgc atcgaggagg aggcgctcgc catggagcgg       240
     agccttgccg gcggcagccg tcagctcgat ggtttactca ggctgtcctc atccgattgg       300
     ttcggcgcgc acgtgctttc gcctgtgttg gcggaattct cgcaagttca tccgaaggtg       360
     gtggtcgaat tgctgactga cagccggctt ctcagtctgt cgcgacgcga agccgacctc       420
     gtctttcgca tccagccttt tacggaagcg gagatcgtat cgcgcaagct tatccgtatc       480
     gaatacggcc tttacatcag tcgcggcgca ccgcaccccg aagccggcga cggcgcgggc       540
     gcccgccttg tcaccatgga cgaggctttc ggcgagatgc cggatgtcgg ctggctgcgg       600
     cgcctgttgc cgcaggccga catcgtcacg cgcagcaaca gccgcgacgt gcaggctgcg       660
     ctctgcgcca acggagccgg gctcgccgtc ctgccgcggc cgctcggcga ttctcttgcg       720
     gccatcgaac tggtcgatct cggtgaaccg ccacccggcc gcgacacctg ggtcggctat       780
     caccgcgaca tgaagcggtt agcgcggctg cgcgccctgc tggaccttgt catcgagagg       840
     ctggcgcgct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page