(data stored in ACNUC7421 zone)

EMBL: CP001622.PE487

CP001622.PE487       Location/Qualifiers
FT   CDS_pept        complement(515710..516606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0493"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_CH00807 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54799"
FT                   /db_xref="GOA:C6B2H9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2H9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54799.1"
FT                   /translation="MTNLGDLEIFAKVVSTGSMSLAGRALGFSPAVVSKRIKRLEDRLG
FT                   TRLLQRTTRQISLTEAGQGFYDRVLGILAGLEEAEFYISGRSAQMHGTLKISAPTSFGR
FT                   MHIAPHLKDFMEAHPELAINLVLTDEFSDIVGGGFDLAIRIAELTDSSLVARRLAPVRR
FT                   LLCASPDYLASHGEPKHIDELKRHRCLPAHNNDTWRLNGPDGALSLRPEGLLVTNSSEV
FT                   IREAVIAGLGIALRSTWDIGEELKAGRLVQVLPAYESSHNVALSAVYPSRQFLPAKVRL
FT                   FIDYLAELYGPVPYWER"
     atgaccaatc tgggtgatct cgaaatcttt gccaaggtcg tttcgaccgg aagcatgtcg        60
     ctcgccggcc gggcactcgg cttttctccg gccgtcgtct ccaaacggat caagcggctg       120
     gaggaccggc tcggcacccg gcttctgcaa cgcacgacgc ggcagatctc gctgacggag       180
     gccgggcagg gcttctacga ccgggttctc ggtattctcg ccgggctcga ggaggcagaa       240
     ttttatatct caggccgctc ggcgcagatg cacggcacgc tgaagatctc tgccccgacc       300
     tccttcgggc gcatgcatat cgcgccgcat ctgaaggatt tcatggaggc gcatccggag       360
     cttgcgatca acctggtgct gaccgacgaa ttcagcgaca tcgtcggcgg cggcttcgat       420
     ctggcgatcc gcattgccga actcaccgat tcgagcctcg ttgcccgaag gctggcgccg       480
     gtgcgccggc tgctctgcgc ctcgccggat taccttgcgt cgcatggcga gccgaagcac       540
     atcgacgagc tgaaacgcca tcgctgcctg ccggcccaca ataacgacac ctggcggctg       600
     aacgggccgg acggggcgct gagtctcagg ccggaaggct tgctcgtcac caattccagc       660
     gaggtgatcc gcgaggcggt catcgccggg ctcgggatcg cgctgcgctc cacctgggat       720
     atcggtgaag agctcaaggc cggccggctg gtgcaggtgc tgccggccta tgagagctcg       780
     cacaatgtcg cgctgtcggc cgtttatccc agccggcagt tcctgccggc caaggtgcgg       840
     ctgttcatcg actatctggc agagctttat ggtcccgtcc cctattggga gcgctga          897
//

If you have problems or comments...

PBIL Back to PBIL home page