(data stored in ACNUC7421 zone)

EMBL: CP001622.PE488

CP001622.PE488       Location/Qualifiers
FT   CDS_pept        516766..518205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0494"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   ret:RHE_CH00808 glycolate oxidase subunit D protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54800"
FT                   /db_xref="GOA:C6B2I0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I0"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ACS54800.1"
FT                   /translation="MSDAISFLEPRADVLARRAQIVADLTDLLPLECLVHEARELVPFE
FT                   TDAFVSYRRLPLAVALPRTTAEVSAVMRYCNRYGIPVVPRGAGTSLSGGAIPQEDAVVL
FT                   GLSKMNSILEIDLPNRVAVVQAGVTNLNISESVSADGFFYAPDPSSQLACTIGGNIGMN
FT                   SGGAHCLKYGVTTNNLLGVRMVLVDGTVIELGGKALDAAGYDLLGLVCGHEGQLGIVTE
FT                   ATVRLIAKPEGARPVLFGFERSEEAGACVADVIAAGIIPVAIEFMDKPAIEICEAFAHA
FT                   GYPLDVGALLIVEVEGSEAEMDAALKDIVEIARRHAVKTVRECQSATEAALIWKGRKSA
FT                   FGATGRIADYICMDGTVPLSQLSYVLQRTAEIVDHYGLRVANVFHAGDGNMHPLILFNA
FT                   NDPEDAARAEAAGNDILRLCVDAGGCLTGEHGVGIEKRDLMRHQYSEVDLTQQMAARAA
FT                   FDPGWLLNPSKVFPLEGRPAA"
     atgtccgacg ccatttcgtt tctcgagccg cgcgccgacg tgctggcgcg ccgcgcccag        60
     atcgttgccg atctcaccga tcttctgccg ctggaatgcc tggtgcatga ggcgcgcgag       120
     ctggtgccgt tcgagaccga cgccttcgtg tcctaccgcc gcctgccgct cgccgtcgcc       180
     ctcccgcgca ccacggctga ggtttcggcc gtcatgcgtt actgcaatcg ctacggcatt       240
     cccgtcgtgc cgcgcggcgc cggcacttcg ctctccggcg gcgccattcc gcaggaggat       300
     gccgtcgtac ttggcctgtc gaagatgaac agcatcctcg aaatcgatct gccgaaccgg       360
     gtcgccgtgg tccaggccgg tgtcaccaat ctcaatatct ccgaatccgt ctccgcggac       420
     ggctttttct atgcgcccga tccgagctcg cagcttgcct gcaccatcgg cggcaatatc       480
     ggcatgaatt ccggcggcgc ccactgtctg aaatatggcg tcaccaccaa caatctgctc       540
     ggcgtcagga tggtactggt cgacggcacc gtgatcgagc tcggcggcaa ggcgctggat       600
     gcggcaggct acgacctgct cggcctcgtc tgcggccacg aaggccagct cggcatcgtc       660
     accgaggcaa cggtgcggct gatcgccaag ccggaaggcg cgcgcccggt gctctttggc       720
     ttcgagagat cggaggaggc cggcgcctgc gttgccgatg tcattgccgc cggcattatc       780
     ccggtcgcaa tcgaatttat ggacaagccg gcgatcgaga tctgcgaggc cttcgcccat       840
     gccggatatc cgctcgatgt cggcgcgcta ttgatcgtcg aggtcgaggg gtcggaagcg       900
     gagatggacg ccgcgctgaa ggacatcgtc gagatcgccc gccggcacgc tgtcaagacc       960
     gtgcgcgaat gccagtcggc gaccgaggcg gcgctgatct ggaagggccg caaatccgcc      1020
     ttcggcgcca ccggccgcat cgccgactat atctgcatgg acggcaccgt gccgctcagc      1080
     cagctttcct acgtgttgca aaggaccgcc gagatcgtcg atcattacgg cttgcgcgtc      1140
     gccaacgtct tccatgccgg cgacggcaac atgcatccgc tgatcctctt caatgccaac      1200
     gatccggagg atgccgcccg tgccgaggcc gccggcaacg atatccttcg gctctgcgtc      1260
     gatgccggcg gctgcctcac cggcgaacat ggcgtcggca tcgagaagcg cgacctgatg      1320
     cggcaccaat attccgaggt cgatctcacc cagcagatgg cggcgcgtgc cgccttcgat      1380
     cccggctggc tcctcaatcc gtcgaaggtc ttcccgctcg aagggcgccc cgccgcatga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page