(data stored in ACNUC7421 zone)

EMBL: CP001622.PE489

CP001622.PE489       Location/Qualifiers
FT   CDS_pept        518202..519401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0495"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000894 glycolate oxidase protein, subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54801"
FT                   /db_xref="GOA:C6B2I1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I1"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACS54801.1"
FT                   /translation="MIDLTPTSEEEAAVIVRAHAESGRPLAICGGNSRSGFGNTVAAEG
FT                   RLRSTGLSGIVAYNPGEMVMTVRSGTSLAEVEAALQESGQMLAFEPMDHRPVMGTSGEP
FT                   TIGGVFAANVSGPRRLIAGAARDSLLGVRFVNGKGEIIKAGGRVMKNVTGLDLAKLVAG
FT                   SHGTLAFLTEVTFRVPPRPKTERTVLLSGLNDAEAANAMAAAMALPVEVSGAAHLPLTV
FT                   TWKFLAGKLPEGEATALRIEGLPGSVDVRIEKLAAAMSGFATVTRLEQPESQKLWQEIR
FT                   DVLPYADGSMRPIWRVSVAPGTGPQLVAALRLEAGVDAFYDWQGGLVWMRMEAGPEAEL
FT                   VRRYIKALGGGHATLIRASGEARATTAAFHPEPEAVTMLSQRVKEKFDPAGIFNPGKMG
FT                   "
     atgatcgacc tgacgccgac gagcgaggaa gaggcagcag tgatcgtccg cgcccatgcg        60
     gaaagcggcc ggccgctggc gatctgcggc ggcaatagcc gctcgggctt cggcaatacc       120
     gttgccgccg agggccggct gcgctcgacc ggactttccg gcatcgtcgc ctataatccc       180
     ggcgaaatgg tcatgaccgt ccgatccgga acgtcgcttg ccgaggtcga ggcggcactt       240
     caggagagcg gccagatgct cgccttcgag ccgatggatc atcgcccggt gatgggcaca       300
     tccggcgagc cgaccatcgg cggcgtcttt gccgccaatg tctccggtcc gcgtcggctg       360
     atcgcgggtg ccgcccgcga cagcctgctc ggggtgcgct tcgtcaacgg caagggtgag       420
     atcatcaagg ccggcggccg agtgatgaag aatgtcaccg gcctcgatct cgccaagctg       480
     gttgccggct cgcatggcac gctggctttc ctcaccgaag tcaccttccg cgtgccgccg       540
     cgcccgaaga cggagcggac ggtgctgcta tcaggcctca acgacgccga ggcggcaaac       600
     gccatggcgg cggcaatggc cctgccggtg gaagtctcag gcgccgccca cctgccgctg       660
     acggtgacgt ggaaattcct cgccggcaaa ttgccggagg gcgaggcgac cgctctgcgc       720
     atcgaaggcc tgccgggctc ggtcgacgta cgcatcgaga agcttgccgc ggcaatgtcg       780
     ggtttcgcca cggtcacgcg gctggaacag ccggagagcc aaaagctctg gcaggaaatc       840
     cgcgacgtgc tgccctatgc cgacggcagc atgcggccga tctggcgcgt ctcggtcgcc       900
     cccggcaccg gccctcagct ggtcgcagcg ctccgcctcg aggcaggcgt cgacgccttc       960
     tacgactggc agggcggcct cgtctggatg cgcatggagg ccggccccga agcggaactg      1020
     gtccgtcgct acatcaaggc gctcggcggc ggccacgcga cgctgatccg tgcatcgggt      1080
     gaggcgaggg cgacaactgc tgcctttcat cccgagcccg aggcggtgac gatgctgtcg      1140
     cagcgggtga aggagaaatt cgatccggcg ggaatcttca atccggggaa gatggggtga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page