(data stored in ACNUC7421 zone)

EMBL: CP001622.PE49

CP001622.PE49        Location/Qualifiers
FT   CDS_pept        complement(50340..51215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54361"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD7"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000432"
FT                   /protein_id="ACS54361.1"
FT                   /translation="MSAIDILNRDTTAEAAPPSTAVQKDGDILGRIGNLETRLARTARE
FT                   IDAAQAVRYRVFVDEMKAQLPLDAMRRQRDVDAYDAVCDHLLVLDRSIEGDPEDQIVGT
FT                   YRLLRQDVAIANGGFYSASEFEIEGLIAKHPDKRFMELGRSCVLPEYRTKRTVELLWQG
FT                   NWAYALKHGVSAMFGCASFPGVYLESHALALSFLYHNVLAKNEWAIGALPHLARNMDLM
FT                   PVEAINPKRALMALPPLIKGYLRLGAMVGSSAVIDHAFNTTDVLIVLPISSISDRYLNY
FT                   YGADAGRFAS"
     atgtccgcca tcgacatcct gaatcgtgac accaccgcgg aggctgcacc gccctcgacg        60
     gctgtgcaga aggacggcga tatcctcggc cgcatcggca atctggagac ccgccttgcc       120
     cgcacggcac gcgagatcga tgccgcccag gccgtgcgct accgcgtctt cgtcgacgaa       180
     atgaaggcgc agctgccgct ggatgcgatg cgccgacagc gcgacgtcga cgcctatgac       240
     gctgtctgcg accatcttct ggttctcgac cgctcgatcg agggcgaccc ggaagaccag       300
     atcgtcggca cctacaggct gttgcgtcaa gatgtcgcca tcgccaatgg cggtttttac       360
     tcggcttccg aattcgaaat cgagggcctc atcgccaaac acccggacaa gcgcttcatg       420
     gaactcggcc gctcctgcgt gctgccggaa taccgcacca agcgcaccgt cgagctcctg       480
     tggcagggca actgggccta tgcgctgaaa cacggcgtca gcgccatgtt cggctgcgcc       540
     tcgttccccg gcgtctatct cgaaagccac gcgctggcac tgtccttcct ctaccacaat       600
     gtgctggcga agaacgaatg ggccatcggg gcgctgccgc atctggcccg caacatggac       660
     ctgatgccgg tcgaagccat caacccgaag cgggcgctga tggctctgcc gccgctgatc       720
     aagggctatc tccgcctcgg cgcgatggtc ggctccagcg cggtcatcga tcatgccttc       780
     aacacgaccg acgtgctgat cgtgctgccg atctccagca tctcggaccg ttacctgaat       840
     tattacggcg ccgatgccgg ccgcttcgcg agctaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page