(data stored in ACNUC7421 zone)

EMBL: CP001622.PE490

CP001622.PE490       Location/Qualifiers
FT   CDS_pept        519653..520963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0497"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: ret:RHE_CH00810
FT                   glycolate oxidase subunit F protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54802"
FT                   /db_xref="GOA:C6B2I2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I2"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACS54802.1"
FT                   /translation="MQTNFTPTQLLDPDVAESEQILRKCVHCGFCTATCPTYVTLGNEL
FT                   DSPRGRIYLIKDMLENGRPADTEVVTHIDRCLSCLACVTTCPSGVDYMHLVDHARAHIE
FT                   KTYKRPFMNRLTRAILAAVLPYPGRFRLALNLARLGRPFAGLMRGGALKPFAAMLALAP
FT                   RRIPAASDFAKPGTHRPETERRGRVAILSGCAQPVLDPGINAAAIRLLTRLGVEVVVPE
FT                   SEVCCGSLVHHMGRAEQALESARANVDIWTREIEGQGLDAIIITASGCGTTIKDYGHML
FT                   RLDPAYAAKAARVSALAKDVTEYLATLDLPAHMPKGITVAYHSACSMQHGQRITLAPKQ
FT                   LLKAAGFTVRDPAEGHFCCGSAGIYNIMQPEISAVLKARKVKNLEATKADIIATGNIGC
FT                   ITQIATGTGIPILHTVELLDWAYGGAVPEKLTGLPLG"
     atgcaaacca acttcacccc gacccagctc ctcgatcccg atgtcgccga atccgagcag        60
     attctgcgca aatgcgttca ctgcggtttc tgcaccgcca cctgtcccac ctatgtgacg       120
     ctcggcaacg agctcgacag cccgcgcggc cgcatctacc tgatcaagga catgctggaa       180
     aacggccgcc ccgccgatac cgaagtcgtc acccatatcg accgctgtct ctcctgcctt       240
     gcctgcgtta ccacctgtcc ctccggcgtc gattacatgc atctggtcga tcacgcccgc       300
     gcccatatcg aaaagaccta caagcgcccg ttcatgaaca ggctgacgcg cgccatcctt       360
     gccgctgtgc tgccctatcc cggtcgcttt cgcctggcgc tcaatctcgc ccgtctcggc       420
     cggcccttcg ccggtctgat gcggggtggc gcgttgaaac ccttcgccgc catgctggca       480
     cttgcgccgc gccgcatccc cgctgcttcg gacttcgcaa aacccggcac gcatcggccc       540
     gaaacggaac ggcgcggccg ggtggcgatc ctttccggct gcgcccagcc ggtgctcgat       600
     cccggcatca acgcggcggc gatccggctg ttgacgcggc tcggcgtcga ggtcgtggtg       660
     ccggaaagcg aggtctgctg cggctcgctg gtgcatcaca tgggtcgcgc cgagcaggcg       720
     ctcgaaagtg cgcgcgccaa tgtcgatatc tggacgcgcg agatcgaggg gcagggcctc       780
     gatgcgatca tcatcactgc ttcgggctgc ggcacgacga tcaaggatta cggccacatg       840
     ctgcgcctcg atcccgccta tgccgcaaag gcggccaggg tctcggcgct ggccaaggac       900
     gtcaccgaat atctcgcaac cctcgacctg ccggcacaca tgccgaaggg tatcaccgtc       960
     gcctatcatt ccgcctgttc catgcagcac ggccagcgca tcacgctcgc gccgaagcaa      1020
     ttattgaaag cggcgggctt tactgtgcgc gatccggcgg aaggccattt ttgctgcggc      1080
     tccgccggca tctacaacat catgcagccg gagatctcgg ccgtgctgaa ggcgcgcaag      1140
     gtcaagaacc tcgaggcgac caaggccgat atcattgcca ccggcaatat cggctgcatc      1200
     acccagatcg ctaccggcac cggcattcca atcctgcata cggtcgaact gctcgattgg      1260
     gcctacggcg gcgctgtgcc ggaaaaatta acaggtttgc cgttaggctg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page