(data stored in ACNUC7421 zone)

EMBL: CP001622.PE491

CP001622.PE491       Location/Qualifiers
FT   CDS_pept        521006..521446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54803"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000896"
FT                   /protein_id="ACS54803.1"
FT                   /translation="MWRGMIVLAGLLGAAGTAHANSRYFCSADDKEARFTLESGFESAA
FT                   GHKLNHFRGALIVKDPAQEAVFGKRVFESQHLTNHWSRNGELLMEVFDGGEDDTGGATL
FT                   DLVVIAGERGKPAANFSGSYSLTIEGGEKPYAVEGKVSCGTK"
     atgtggcggg gaatgattgt gcttgcggga ctgctcggtg cggcaggcac cgcccatgca        60
     aatagccgtt atttctgttc cgccgacgac aaggaagcgc gcttcacgct cgaaagcggt       120
     ttcgaaagcg ccgccggcca caagctcaac cacttccgcg gcgcgctgat cgtcaaggat       180
     ccggcccaag aggccgtgtt cggaaagcgt gttttcgaat cgcagcacct gaccaaccat       240
     tggtcgcgta acggcgaact gctcatggaa gtcttcgacg gtggcgaaga tgacactggc       300
     ggcgcaacgc tggatctggt ggttatcgcc ggcgagcgcg gcaagccggc ggcaaatttt       360
     agcggcagct attccctgac tatcgaaggc ggtgaaaaac cctatgccgt cgagggtaag       420
     gtcagctgcg gcacgaaata g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page