(data stored in ACNUC7421 zone)

EMBL: CP001622.PE492

CP001622.PE492       Location/Qualifiers
FT   CDS_pept        complement(521474..522148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0499"
FT                   /product="lipid A oxidase (involved in formation of
FT                   2-aminogluconate) protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000897 lipid A oxidase
FT                   (involved in formation of 2-aminogluconate) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54804"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000897"
FT                   /protein_id="ACS54804.1"
FT                   /translation="MTSALRSSASLLAGIAFLTICSAVSASAEDLQFSIYGGYQTAPHS
FT                   GVDLSDGTHFTAGWEGKSFGSPPYYGGRVTWWLENFNKPNWGISLDYTHDKVYADDDTL
FT                   AKAGWSHFEFTDGLNLLTVNGLYRFQDPTRRWTPYLGAGIGVNIPHVEVIRPEGKTWAY
FT                   EFGGVTLQAQAGVDFKVTERWSTFVEYKGTYSRVDVPIDSGVDLKTNIFTNAVNVGVSF
FT                   HW"
     atgacatctg cgctgcgttc ttccgcttcc ctgcttgcgg gcatcgcgtt tttgacaatc        60
     tgttcagcag tttccgcctc ggcggaagac ctgcaattct ctatctacgg cggctaccag       120
     accgcgccgc atagcggcgt cgatctttcc gacggcacgc acttcaccgc cggctgggaa       180
     ggcaagtcct tcggcagccc gccttattac ggcggtcgcg tcacctggtg gctcgagaac       240
     ttcaacaagc cgaactgggg tatttcgctc gattataccc atgacaaggt ctatgccgac       300
     gacgatacgc tggcaaaggc cggctggtcg catttcgaat tcaccgacgg cctgaacctc       360
     ctcacggtga acggtctcta ccgtttccag gatccgaccc gccgctggac cccctatctc       420
     ggcgccggta tcggcgtgaa cattccgcat gtcgaagtga ttcgtcccga gggcaagacc       480
     tgggcttatg aattcggcgg cgtgacgctg caggcccagg ccggcgtcga cttcaaggtg       540
     accgagcgct ggtcgacctt cgtcgaatac aagggcacct attcgcgcgt cgacgttccg       600
     atcgacagcg gcgtggacct gaagaccaac atcttcacga acgccgtcaa cgtcggcgta       660
     tcgttccact ggtaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page