(data stored in ACNUC7421 zone)

EMBL: CP001622.PE493

CP001622.PE493       Location/Qualifiers
FT   CDS_pept        complement(522269..522961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0500"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   ret:RHE_CH00813 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54805"
FT                   /db_xref="GOA:C6B2I5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I5"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACS54805.1"
FT                   /translation="MIKLMPGLAAAGLVLSLMSTSAFAAPAGSAPDNARAPAQIVRVAQ
FT                   MPKYVKPQFKRKKVRLATTEAAGTVIIDTNNKYLYLVEGNNRATRYGIGVGRDGFGWSG
FT                   VVKIGRKAEWPGWTPPAEMRRREAAKGHMIPAFQEGGEDNPLGARAMYLYQGGRDTIFR
FT                   IHGTNQPWTIGLNMSSGCIRMMNEDVSHLYDRAPVGTKVIVIGPGNRQGKVAFEDRGID
FT                   VLRTMFGG"
     atgatcaaac taatgccggg tctggctgct gccggacttg tcctgtcctt gatgtctaca        60
     tccgcctttg cagcacctgc gggctccgcg cccgacaatg cacgggcacc ggcacagatc       120
     gtgcgcgtcg cgcagatgcc gaaatatgtg aagccgcagt tcaagcgcaa gaaagtgcgc       180
     ctggcaacga cggaagccgc cggcaccgtc atcatcgata ccaacaacaa atatctctac       240
     ctcgtcgaag gcaacaatcg cgccacccga tacggcatcg gcgtcggccg cgacggcttc       300
     ggctggtcgg gggtcgtcaa gatcggccgc aaggccgaat ggccgggctg gacgccgccg       360
     gccgagatgc gccgccgcga agccgccaaa ggacatatga ttcctgcttt ccaggagggc       420
     ggtgaggaca atccgctcgg cgcccgcgca atgtatctct accagggcgg ccgcgacacc       480
     atcttccgca tccacggcac caatcagccc tggacgatcg gcctcaacat gtcttccggc       540
     tgcatccgga tgatgaacga ggatgtgtcg catctctacg atcgcgcgcc cgtcggcacc       600
     aaggtgatcg tcatcggccc cggcaacagg cagggcaagg tggcattcga ggacaggggc       660
     atcgacgtgc tgcgtacgat gttcggcggc tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page