(data stored in ACNUC7421 zone)

EMBL: CP001622.PE494

CP001622.PE494       Location/Qualifiers
FT   CDS_pept        complement(523202..523951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0501"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   ret:RHE_CH00814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54806"
FT                   /db_xref="GOA:C6B2I6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I6"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACS54806.1"
FT                   /translation="MMKQLVLAAALFGIFSTAAIADDRYATRPPVVLSPDLTAPWINQL
FT                   GGGRVRPVVYQRPVVQPQQRGLFQRRIIRRAPQVSPQTVSAINPGIPSIRRPIEPQYLP
FT                   QVVDYDTTEKPGTIVIDTNNRFLYLVMQGGKARRYGVGVGKPGFEWAGAHKITRKTEWP
FT                   DWTPPSEMISREAAKGHYLPARMDGGAENPLGARAMYLGSTLYRIHGTNAPWSIGSAVS
FT                   SGCIRLRNEDVVDLYDRVNVGTRVIVM"
     atgatgaaac agcttgttct tgccgcagcc ctcttcggga ttttctccac ggccgccatt        60
     gcagacgacc gctacgccac ccgcccgccc gttgtgctca gccccgatct gaccgcaccg       120
     tggatcaacc aactgggcgg cggcagggtt cgtcccgtcg tctatcagcg gccggtcgtc       180
     cagccgcagc agcgcggcct tttccagcgc cggatcatcc gacgggcgcc gcaggtgtca       240
     ccgcagaccg tttcggcgat caatcccggc atcccgtcga tccgtcgtcc gatcgaaccg       300
     caatacctgc cgcaggtggt cgactacgat accacggaaa agcccggcac gatcgtcatc       360
     gataccaaca accgcttcct ctatctggtg atgcaaggcg gcaaggcgcg gcgctacggc       420
     gtcggcgtcg gcaagccggg cttcgaatgg gccggcgccc acaaaatcac ccgcaagacc       480
     gaatggccgg attggacgcc gccttccgag atgatcagcc gcgaagccgc caagggccat       540
     tacctgccgg cgcgcatgga cggcggggcg gaaaacccgc ttggcgcccg cgccatgtat       600
     ctcggctcga cgctttaccg catccacggc accaacgccc cctggtcgat cggcagcgcc       660
     gtctcctccg gctgcatccg cctgcgcaac gaagacgtcg tcgacctcta cgaccgcgtc       720
     aatgtcggaa cccgcgtcat cgtcatgtaa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page