(data stored in ACNUC7421 zone)

EMBL: CP001622.PE495

CP001622.PE495       Location/Qualifiers
FT   CDS_pept        524200..524829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0502"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG:
FT                   rec:RHECIAT_CH0000900 DNA-3-methyladenine glycosylase I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54807"
FT                   /db_xref="GOA:C6B2I7"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I7"
FT                   /inference="protein motif:PRIAM:3.2.2.20"
FT                   /protein_id="ACS54807.1"
FT                   /translation="MSATGIIIGEDGRSRCHWHANLPDYLRYHDEEWGRPVTDDIRLFE
FT                   KICLEGFQSGLSWLTILRKRENFRAAFSGFDFDKVALFGEEDVARCLGDAGIIRHRGKI
FT                   VSTINNAKRAIELRGEFGSLAHYFWRYEPGHNERPAVVDREHIVANPTTPTSVVISKDL
FT                   KKRGWTFVGPTTVYAFMQAMGLVNDHLEGCFCRPEVEAMRTALVRP"
     atgagcgcga caggcatcat catcggcgag gacggcagga gccgctgcca ctggcacgcc        60
     aatctgcccg actatctccg ctatcatgac gaggaatggg gccgccctgt caccgatgat       120
     atccgcctct tcgagaagat ctgcctcgaa ggcttccagt cgggcctttc ctggctgacg       180
     atcctgcgca aacgcgagaa tttccgcgcc gccttttcag gtttcgattt cgacaaggtc       240
     gcccttttcg gcgaagagga tgtcgctcgc tgccttggcg atgccggcat catccgccat       300
     cgcggcaaga tcgtctcgac catcaacaat gccaagcgcg ccatcgaact ccgcggcgaa       360
     ttcggctcgc tcgcccatta tttctggcgc tacgagcccg gccataacga gcggccggcg       420
     gtggtcgacc gcgagcacat cgtcgccaat ccgacgacgc cgacatcggt ggtcatttcg       480
     aaggatctga agaaacgcgg ctggaccttt gtcggcccga ccacagttta tgctttcatg       540
     caggcgatgg gtctcgtcaa cgatcatctg gaaggctgct tctgccggcc cgaggtcgag       600
     gcgatgcgca ctgctctggt tcgcccatga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page