(data stored in ACNUC7421 zone)

EMBL: CP001622.PE496

CP001622.PE496       Location/Qualifiers
FT   CDS_pept        524826..525332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000901 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54808"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000901"
FT                   /protein_id="ACS54808.1"
FT                   /translation="MKDHAVRTLIAAAALFLLTVSAMAQTPQLDPGEKLEKLQFPAVTM
FT                   QLKGWTKFGNGHVYTLPVRAGQHMKISFSTKSKFAFLAIFDLSKPDDEAFFGTDEDGMS
FT                   FETTIKENATWLLRPYYSKVSPRRGLGAPFSILIEPLAAAPQQPKPPAEPERPSLFPKA
FT                   PPKPQ"
     atgaaagatc acgccgtgag aacactgatc gccgccgctg cccttttcct cctgaccgtc        60
     tccgccatgg cgcagacgcc gcagctcgat cccggtgaga agctggagaa gctgcaattc       120
     ccggccgtca ccatgcagtt gaagggctgg acgaagttcg gcaatggcca tgtctatacg       180
     ctgccggtgc gagccggtca gcatatgaag atcagctttt cgaccaaaag caaatttgcc       240
     ttcctggcga ttttcgacct gtcgaaaccc gatgacgagg ccttcttcgg caccgacgag       300
     gacggcatga gcttcgagac gacgatcaag gaaaacgcca cctggctgct gcgcccctat       360
     tattccaagg tctcgccgcg ccgcggcctc ggcgctccct tcagcatcct gatcgagccg       420
     ttggcggctg ccccgcagca gccgaaaccg ccggccgagc cggagcgccc ctcgctgttc       480
     ccgaaggccc cgcccaagcc gcaatga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page