(data stored in ACNUC7421 zone)

EMBL: CP001622.PE497

CP001622.PE497       Location/Qualifiers
FT   CDS_pept        complement(525352..526056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0504"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: rec:RHECIAT_CH0000902 putative hydrolase
FT                   protein, HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54809"
FT                   /db_xref="GOA:C6B2I9"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2I9"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACS54809.1"
FT                   /translation="MTTRPLTTIGFDADDTLWQNEQYYRLTEAHFTGLLADFAEGPKIS
FT                   ERLLEAEKRNLRHYGFGIKGFTLSMIETAIEITEGKIPAGVIAKILDTGRELLSHPVET
FT                   MPHVRDTLEALAGKYLLVMITKGDLFDQERKLAQSGLGDFFDAVEIVSDKTAVTYRRIF
FT                   AKVGDGPERAMMVGNSLKSDIVPAIAAGSYGVFVPHELTWVLEHVDEPKEAPRFRKIDH
FT                   LGELRDLIDRLG"
     atgacgacgc gaccactgac cacgatcggc ttcgatgccg acgatacact ctggcagaac        60
     gaacaatatt accggctgac ggaagcccat ttcaccgggc ttcttgccga tttcgccgaa       120
     ggaccgaaga tttccgaacg gctgctggag gccgaaaaac gcaaccttcg ccactacggc       180
     ttcggcatca agggttttac gttgtcgatg atcgagacgg cgatcgagat caccgagggc       240
     aagattccgg ccggcgtgat cgccaagatt ctcgataccg gccgcgagct cctctcccat       300
     cctgtcgaga ccatgccgca tgtgcgcgac acgctggagg cgcttgccgg caaatacctg       360
     cttgtcatga tcaccaaggg cgatctcttc gaccaggagc gcaagctcgc ccaatcgggg       420
     ctcggcgact tcttcgatgc cgtcgagatc gtctccgaca agacggcggt cacctatcgc       480
     cgcatcttcg ccaaggtcgg cgacgggccg gagcgggcaa tgatggtcgg caattcgctg       540
     aaatcggaca tcgtgccggc gatcgccgcc ggcagctacg gcgtcttcgt gccacacgaa       600
     ctgacctggg tgctggaaca tgtggacgag ccgaaagagg cgccgcgttt ccgcaagatc       660
     gaccacctcg gcgaattgcg cgacctgatc gaccggctcg gctaa                       705
//

If you have problems or comments...

PBIL Back to PBIL home page