(data stored in ACNUC7421 zone)

EMBL: CP001622.PE498

CP001622.PE498       Location/Qualifiers
FT   CDS_pept        526294..527343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0505"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: ret:RHE_CH00818
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54810"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J0"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS54810.1"
FT                   /translation="MRYNQLGNTGLFVSEICLGTMTFGEAKQGTAWGAIADVDQNAADR
FT                   IVERSLASGVNFIDTADVYSTGESERLLGQALKNLDIQRKDVVIATKVYGVMGDKPNDR
FT                   GASRGHIMDSVEASLKRLQTDHIDLYQIHATDTVTPIEETLRAFDDLVSRGLVRYIGVS
FT                   NWQAWRISKALGLSERRGFARFETVQAYYSIAGRDLERDIVPMMQEEKLGLMVWSPLAG
FT                   GLLSGKYGPGAPGNGEGRRASFDFPPVDKDKAWACVAVMREVAEKHGVSVATVALAYIL
FT                   AKPFVTTVIIGAKRVDQLDQNLAAVKLKLDEGDIKKLDEVSALAPEYPGWMLARQGAGR
FT                   RPADFEPKD"
     atgcgttaca atcaactcgg aaataccgga cttttcgtct cggaaatctg cctgggcacg        60
     atgaccttcg gcgaagccaa gcaaggcact gcctggggcg ccatcgccga cgtcgatcag       120
     aatgccgccg accggatcgt cgagcgctcg cttgcatcag gcgtcaattt catcgacacg       180
     gccgacgtct attcgaccgg cgagtccgaa aggttgctcg gccaggcgct gaagaacctc       240
     gacatccaac gcaaggacgt cgtcatcgcc accaaggtct acggcgtcat gggcgacaag       300
     ccgaacgacc gcggcgcctc gcgcggtcac atcatggact cggtcgaggc gagcctcaag       360
     cggctgcaga ccgatcatat cgatctctat cagatccatg cgaccgatac ggtgacgccg       420
     atcgaggaga cgctacgcgc tttcgacgat ctcgtgtccc gtggtctcgt gcgctacatc       480
     ggcgtctcca actggcaggc ctggcgcatt tccaaggcac tcggcctgtc ggagcgccgc       540
     ggctttgccc gtttcgaaac cgtgcaggcc tattactcca tcgccggccg cgatctcgaa       600
     cgcgacatcg tgccgatgat gcaggaggaa aagcttggcc tgatggtctg gtccccgctc       660
     gccggcggtc tgctctccgg caagtacggt cccggcgcgc ccggcaatgg tgaaggccgc       720
     cgcgccagtt tcgatttccc gcccgtcgac aaggacaagg cctgggcctg tgtcgccgtc       780
     atgcgcgaag tcgccgaaaa gcacggcgtc agcgtcgcca ccgtcgcgct cgcctatatc       840
     ctggccaagc ccttcgtcac gacagtcatc atcggcgcca agcgtgtcga tcagctcgac       900
     cagaaccttg ccgccgtcaa gctgaagctc gatgaagggg atatcaagaa gctcgacgag       960
     gtgagcgcgc ttgcgcccga atatccgggc tggatgctgg cgcgacaggg cgccggccgc      1020
     cgcccggccg atttcgagcc gaaggactga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page