(data stored in ACNUC7421 zone)

EMBL: CP001622.PE499

CP001622.PE499       Location/Qualifiers
FT   CDS_pept        complement(527408..527767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0506"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   rec:RHECIAT_CH0000904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54811"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J1"
FT                   /inference="protein motif:PFAM:PF03713"
FT                   /protein_id="ACS54811.1"
FT                   /translation="MSLKIITLTAMLAIIAAPVLAKDKPMDMSKPMGNHDAASHAFSEA
FT                   NAKMHKDMMIDYSGDADADFVRGMIPHHQGAIDMARIELQYGKDPDIRKLAEAVIRAQE
FT                   AEIAEMNAWLKAHGK"
     atgtctttga aaatcatcac cctcaccgca atgctcgcca tcattgccgc tcccgtcctt        60
     gccaaagaca agccgatgga catgagcaag ccgatgggca accacgatgc ggcgagccac       120
     gccttcagcg aggcgaacgc caagatgcac aaggatatga tgatcgacta tagcggcgat       180
     gccgatgcgg atttcgtccg cggcatgatc ccgcatcatc agggtgcgat cgatatggcc       240
     aggatcgagc tgcaatacgg aaaagatccc gatatccgca aactcgccga agccgtcatc       300
     agggcgcagg aagccgaaat cgccgagatg aacgcctggc ttaaggccca cggcaagtag       360
//

If you have problems or comments...

PBIL Back to PBIL home page