(data stored in ACNUC7421 zone)

EMBL: CP001622.PE5

CP001622.PE5         Location/Qualifiers
FT   CDS_pept        complement(4750..5166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0005"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ret:RHE_CH00362
FT                   lactoylglutathione lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54317"
FT                   /db_xref="GOA:C6AY93"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY93"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS54317.1"
FT                   /translation="MLEGMLETALYARDLDQAETFYEDVLGLEKIARAANRHVFFRCGP
FT                   GVLLIFNPEETVKPPAPEALQVPPHGTTGQGHACFRVSGRNIDAMAERLTAAGVAIESE
FT                   VRWPKGGRSIYFRDPAGNSLECAEAKIWGIEQDI"
     atgctggaag gcatgttgga aacggcgctc tatgcgcggg atctcgacca ggccgagacg        60
     ttctacgaag acgttctcgg acttgaaaag atcgcccgcg ccgccaaccg gcatgtcttc       120
     ttccgctgtg ggcctggcgt tctcctgatc ttcaatcccg aggaaacggt aaaaccgcca       180
     gcgcctgaag cactgcaggt accgccgcac ggcacgaccg gccagggcca cgcctgtttc       240
     cgggtgtccg gccgcaatat cgatgccatg gccgagcggc tgacggcggc gggtgtggcg       300
     atcgaatccg aagtgcgctg gccgaagggc ggccgctcga tctatttccg cgatccggcc       360
     ggtaacagtc tggaatgcgc ggaggctaaa atctggggca tcgaacagga catctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page