(data stored in ACNUC7421 zone)

EMBL: CP001622.PE50

CP001622.PE50        Location/Qualifiers
FT   CDS_pept        complement(51324..53606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0051"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; KEGG: rec:RHECIAT_CH0000433 putative two-component
FT                   sensor histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54362"
FT                   /db_xref="GOA:C6AYD8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54362.1"
FT                   /translation="MQNLGQLQERLSAAFGGPAAKPHEKRMEAVFARPNAPAPRGADDR
FT                   QDGPAPTRRLLFYWLGGAGLLAATILMLLAHAGDPLLLSGGLVVLGLAVIASYALLMVR
FT                   SRKAGQRPGQSMPDENGGAKLFADVHDVLGDITVSRTMDRRIISANDTFRRLTGRLRPE
FT                   GKTCEEIGLAFRPGPIPHCYDVEISTPEGQRIFLWRDVVTRDPANGRLLLQSVARDVTD
FT                   ERLIAQGREEARQKAEYNSAAKSRLLATVSHEVRTPLSGILGMTHLIAETRLTQEQQNY
FT                   LANIRQSGHALTQLVEDLLDFSTIEVGRFALHPRSESLRKLLESVVEMLAHRAHEKGIE
FT                   IGATVSSDVPENMSFDPARLRQVLFNVIGNAVKFTQVGGVFIRVSLDDDDLSITVTDSG
FT                   PGMTTEEQARVFGEFEQGGSVVDKSSGTGLGLAISARIMREFNGALTVASEKGRGSEFT
FT                   ICFPVDIDSERPDRRNTLLSGNSVVLLAPAGAARTAIAETITTLGGLCHLVGDGETARA
FT                   TLLELAKGGRRPTDIIIDHRMSAEFSAHLADRAEIAALGLRKVLLVNPEERSAHPLDLF
FT                   DAWLIRPLREQSLIDVLRGRMRGMEKRDALNDNQPGFGLSVAETLVAASGLSILLGEDD
FT                   PINAMLVRVVLEKGGHKVRHVEDFETLLDYALCEANARPDIIISDLSMPGGNGIDMLGR
FT                   LRGHERRLDLASVPVIVLTADKSDESRRQVLLNGANRVMVKPVDPVRLLTEVQAVAALS
FT                   ARRAEAR"
     atgcagaacc tgggacagtt gcaggaaaga ttgtccgccg ccttcggtgg acccgccgcc        60
     aagccgcatg agaagcggat ggaggcggtc ttcgcacgac cgaacgcacc ggcaccccgg       120
     ggcgccgatg accgccagga cggacctgca ccgacacggc gcctgctgtt ctactggctc       180
     ggcggcgccg gccttcttgc cgcaacgatc ctgatgctgc ttgcccatgc cggcgatccg       240
     ctgctgcttt cgggcggtct cgtcgtcctt ggcctggccg tcatcgccag ttatgccctg       300
     ctgatggttc gctcgcgcaa ggccgggcag cgccccggtc aatccatgcc ggatgagaat       360
     ggcggcgcaa agctgtttgc cgacgtgcac gacgtgctcg gcgacatcac ggtcagccgc       420
     accatggacc ggcgcatcat ctccgccaat gacacgtttc gccgcctgac cgggcggctg       480
     cgtccggaag gaaaaacctg cgaggagatc ggccttgcct tccgccccgg tccgataccg       540
     cattgctacg atgtcgagat ctcgacgccg gaaggccagc gcatcttcct ctggcgtgac       600
     gtcgttaccc gcgacccggc gaacggccgc ctgctgctgc aaagcgttgc ccgcgacgtg       660
     accgacgagc ggctgatcgc gcagggccgc gaggaagccc gccagaaggc cgaatataac       720
     agcgccgcga aatcgaggct gcttgccacc gtcagccacg aggtgcgcac gccgctttcg       780
     ggcatcctcg gcatgacgca tctgatcgcg gagacgcggt tgacgcagga gcagcagaac       840
     tatctcgcga acatccgcca gtccggccat gcattgacgc agctcgtcga ggatctgctc       900
     gatttctcca ccatcgaagt cggccgcttc gcgctgcacc cgcgctcgga atcgctgcgc       960
     aagcttctgg aaagcgtcgt cgagatgctc gcccaccggg cgcatgaaaa gggtatcgag      1020
     atcggcgcca ccgtgtcctc cgacgtgccc gaaaatatga gcttcgaccc ggcgcggctg      1080
     cgccaggttc tgttcaacgt catcggcaat gccgtgaagt tcacccaggt tggcggcgtc      1140
     ttcatccgcg tgtcgctcga cgacgacgac ctctcgatca ccgtgaccga tagcggtccc      1200
     ggcatgacga cggaggagca ggcgcgcgtc ttcggcgagt tcgagcaggg cgggagcgtt      1260
     gtcgacaaga gcagcgggac cggcctcggc cttgccatct ccgcccgcat catgcgcgaa      1320
     ttcaacggcg cgctgacggt tgccagcgaa aagggccgag gcagcgaatt caccatctgc      1380
     ttccctgtcg atatcgacag cgagcgcccc gaccggcgaa acacgctgct ttcaggcaac      1440
     agcgtcgtgc tactggcgcc ggcaggtgcg gcgcgcaccg ccatcgccga aacgatcacc      1500
     acgctcggcg gcctctgcca tctcgtcggc gacggcgaga cggcgcgggc aacgctgctc      1560
     gagctggcaa agggcgggcg gcggccgacc gatatcatca tcgaccatcg gatgtcggcg      1620
     gaattttccg cccatcttgc cgatcgcgcc gaaatcgccg cccttggcct gcgcaaggtc      1680
     ctgctcgtca atccggaaga gcgcagcgcc catccgctcg acctcttcga tgcctggctg      1740
     atccggccgc tgcgcgaaca gtcgctgatc gacgtgctgc gcgggcgcat gcgcggcatg      1800
     gagaagcgcg acgcgctgaa cgacaaccag ccgggcttcg gcctttcggt agcggagacg      1860
     ctggttgccg ccagcgggct cagcatcctg ctcggcgagg acgatccgat caatgccatg      1920
     ctggtgcgcg tcgtcctgga aaagggcggg cataaggtgc gccatgtcga ggatttcgag      1980
     accctgctcg actacgcgct ctgcgaggcc aatgcccggc ccgatatcat tatcagcgac      2040
     ctctcgatgc ctggcggcaa cggcatcgac atgctgggac gcctgcgcgg ccatgagcgg      2100
     cggctcgatc tcgcctcggt gccggtgatc gtgctgacgg ccgacaagag cgacgaatcg      2160
     cgccgccagg tcttgctcaa cggcgccaac cgcgtcatgg taaagccggt cgatccggtg      2220
     cggctgctga ccgaagttca agcggttgcc gccctttccg cccgccgggc agaggcgcgg      2280
     tga                                                                    2283
//

If you have problems or comments...

PBIL Back to PBIL home page