(data stored in ACNUC7421 zone)

EMBL: CP001622.PE500

CP001622.PE500       Location/Qualifiers
FT   CDS_pept        complement(527843..528208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54812"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J2"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000905"
FT                   /protein_id="ACS54812.1"
FT                   /translation="MRMLALITMFLGWLVYSAMSAWAGCPTCASMNAPVVVENGMHHQM
FT                   AGMDRHEAADTADPLKDPCATGNSAHMPLCVACLLLPATVTVMDGGKSIFGYPAPALAR
FT                   ALDDDKPTPQPPPPRLS"
     atgcgcatgc tcgccctcat cacgatgttt ctcggctggc tggtctacag cgccatgtcc        60
     gcatgggccg gctgcccgac ctgtgcgtcg atgaatgcgc cggtcgtcgt cgaaaacggc       120
     atgcaccatc agatggctgg catggatagg catgaggcgg ctgatacggc cgatccgttg       180
     aaagaccctt gcgccaccgg caactccgcg catatgccgc tttgcgtcgc ctgtcttttg       240
     ctgccagcga cggtgacggt catggatggc ggaaagtcca ttttcggcta tcccgccccg       300
     gcgcttgccc gcgccctgga cgacgacaag ccgacgccgc agccgccccc tccccgactg       360
     tcctga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page