(data stored in ACNUC7421 zone)

EMBL: CP001622.PE501

CP001622.PE501       Location/Qualifiers
FT   CDS_pept        complement(528266..529021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54813"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000906"
FT                   /protein_id="ACS54813.1"
FT                   /translation="MITEALLYAATLPLTGKPHRKFIRYSVNLWSRAGRCAADWAEHEE
FT                   MSRKAILAATADLRQKRTAVVLGSGLLRDVPIEVLARDFDTVVLVDLVHLASVRLWLSA
FT                   KFHRNVQLIERDLSGYDDLAAGREPEPLGFLRAVPYLDLVVSANLLSQIGRGVKRRHGA
FT                   EAGRMPEDTVERLIAAHLTGLSGLPCRNCLVTDIAYAVIDRNGKTHEEADLLHGVLPPP
FT                   AKAAWTWPVAPLGEESKDYRIEHNVMAAW"
     atgatcactg aggcgcttct ctatgccgca accttgccgc tgaccggcaa gccgcatcga        60
     aagttcatcc gctattccgt caatctctgg tcgcgggccg ggcgctgcgc ggcggattgg       120
     gccgaacatg aggagatgag ccggaaggcg atcctggcgg cgacggccga tctcagacag       180
     aagcggaccg ccgtcgtcct cggctccggc ctgttgcgcg atgtaccgat cgaagtgctg       240
     gcgcgagatt tcgacaccgt cgtcctggtc gatctcgttc atctcgcctc ggtgcgcctg       300
     tggctgtcgg ccaagttcca tcgcaatgtc caactgatcg agcgcgatct ttccggctac       360
     gacgacctcg ccgccggccg cgagcccgaa ccgctcggct ttttgcgtgc tgtgccctat       420
     ctcgatttgg tggtatccgc caacctgttg tcgcagatcg gccgcggtgt gaaacggcgc       480
     catggggccg aggcggggcg aatgcctgaa gacacggtgg aaaggctgat cgcggcgcac       540
     ctgaccgggc tttcggggct tccctgccgc aactgcctgg taaccgacat cgcctatgcc       600
     gtcatcgacc gcaacggcaa gacgcatgaa gaggccgacc tgctgcatgg cgttttgccg       660
     ccgccggcaa aagccgcctg gacatggccg gtcgcgccgc tcggcgaaga gagcaaggat       720
     tataggatcg agcacaatgt catggctgct tggtga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page