(data stored in ACNUC7421 zone)

EMBL: CP001622.PE502

CP001622.PE502       Location/Qualifiers
FT   CDS_pept        529158..530678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0509"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: rec:RHECIAT_CH0000907 histidyl-tRNA synthetase
FT                   protein; TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54814"
FT                   /db_xref="GOA:C6B2J4"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J4"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ACS54814.1"
FT                   /translation="MNDKQKKPQKLKARLPRGFVDRTAGDIRAVNEMTAKIREVYEHYG
FT                   FDPLETPLFEYTDALGKFLPDSDRPNEGVFSLQDDDEQWMSLRYDLTAPLARHVAENFN
FT                   EIQLPYRTYRAGYVFRNEKPGPGRFRQFMQFDADTVGAPGVQADAEMCMMMADTLEALG
FT                   IKRGDYLIRVNNRKVLDGVLEAIGLGGDDKAGQRLNVLRAIDKLDKFGPEGVALLLGPG
FT                   RKDESGDFTKGAGLDKEQIDKVLFFVGITDYAESVARLAELVAGTARGGEGVDELNFIG
FT                   ALVTSAGYGPDRIKIDPSVVRGLEYYTGPVYEAELTFDVTNEKGEKVVFGSVGGGGRYD
FT                   GLVSRFMGQPVPATGFSIGVSRLMTALKNLGKLGASEVIEPVLVTVMDGDVEAMGRYQK
FT                   MTQELRAAGIRAEMFQGNWKKFGNQLKYADRRGCPVAIIQGGDERATSVVQIKDLIEGK
FT                   RLSGEIEDNASWREARVAQETVPEADLVAKVREILAAQAEDRKRAANV"
     atgaacgaca agcagaagaa accgcaaaag ctcaaggccc gcctgccgcg cggcttcgtc        60
     gaccggacgg ccggcgatat ccgcgccgtc aacgagatga cggcaaagat ccgggaagtc       120
     tatgagcatt atggtttcga tccgctcgaa acgccgctgt tcgaatatac cgatgcgctc       180
     ggcaagttcc tgcctgacag cgaccggccg aacgagggcg tcttctcgct gcaggacgat       240
     gacgagcagt ggatgtcgct gcgttacgac ctgaccgcgc cgctcgcccg tcatgtcgcc       300
     gagaatttca acgaaatcca gctgccctat cgcacctatc gcgccggtta cgtcttccgc       360
     aacgagaagc ctggccccgg ccgcttccgc cagttcatgc agttcgatgc cgataccgtc       420
     ggtgcgccgg gcgtgcaggc cgatgccgaa atgtgcatga tgatggccga tacgctggaa       480
     gccctcggta tcaagcgcgg cgattacctc attcgcgtca ataaccgcaa ggttctggat       540
     ggcgtgctcg aagcgatcgg tctcggcggc gacgacaagg ccggccagcg gctcaacgtg       600
     ctgcgcgcca tcgacaagct cgacaagttc ggcccggagg gcgtggccct gctgctcggt       660
     cccggccgca aggatgaatc cggcgacttc accaagggtg ctggtctcga caaggagcag       720
     atcgacaagg tgctgttctt cgtcggcatc acggactatg ccgaaagcgt tgcccgcctc       780
     gccgagctgg ttgcgggaac cgccaggggt ggcgagggcg tcgacgagct gaatttcatc       840
     ggtgcgctgg ttaccagcgc cggttatggc cctgaccgca tcaagatcga tccctcggtt       900
     gtccgtggcc tcgagtatta taccggcccg gtctatgagg ccgaactgac cttcgacgtc       960
     accaatgaaa agggcgaaaa agtcgtcttc ggttcggtcg gcggcggcgg ccgttatgat      1020
     ggcctcgtct cccgcttcat gggccagccg gttccggcga ccggcttttc gatcggcgtc      1080
     tccaggctga tgacagccct gaagaacctc ggcaagctcg gcgccagtga ggtcatcgag      1140
     ccggtgctgg tgaccgtcat ggacggcgat gtcgaggcga tgggccgcta tcagaagatg      1200
     acgcaggaac tgcgcgccgc cggcatccgc gccgagatgt tccagggcaa ctggaagaag      1260
     ttcggcaatc agctgaaata tgccgatcgc cgcggctgcc cagtcgccat catccagggc      1320
     ggcgacgagc gcgcgacaag cgtcgtgcag atcaaggatt tgatcgaagg caagcggctc      1380
     tccggcgaga ttgaagacaa tgccagctgg cgcgaggcgc gcgtggcgca ggagacggtc      1440
     ccggaagccg acctcgtcgc caaggtcagg gagatccttg ctgcgcaggc cgaggatcgg      1500
     aagcgagcgg cgaatgtctg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page