(data stored in ACNUC7421 zone)

EMBL: CP001622.PE503

CP001622.PE503       Location/Qualifiers
FT   CDS_pept        530721..531842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0510"
FT                   /product="tRNA synthetase class II (G H P and S)"
FT                   /note="PFAM: tRNA synthetase class II (G H P and S); KEGG:
FT                   ret:RHE_CH00822 ATP phosphoribosyltransferase regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54815"
FT                   /db_xref="GOA:C6B2J5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J5"
FT                   /inference="protein motif:PFAM:PF00587"
FT                   /protein_id="ACS54815.1"
FT                   /translation="MPLINLPEFANDLIAEFDARNAERIDTPVIQPAEPFLDIAGEDLR
FT                   RRIFMTESETGASLCLRPEFTIPVCLRHIETATGTPKRYAYLGEVFRQRRDGANEFYQA
FT                   GIEDLGDIDLSNADARAIGDATGILARLLPGRRLAVTLGDQAVFEAVVQALGLPLGWQK
FT                   RLIHAFGNMTQLEALLASLVSPQFVTGLDDDIARLVASDDEQALVAYLEREMQKTGYST
FT                   NAGRSALEIARRLKEKLILSETRLDDAAFRVLEEFLSLDVPLINASAALSGFADAAGLK
FT                   LGNALARFNGRVAALSNAGVDLSCLDYRAAFGRPLDYYTGLVFEVTVEGSTAVLAGGGR
FT                   FDRLLTFLGATDRIPAVGFSFWLDRIETERAAA"
     atgcccctga tcaatctccc cgaatttgcc aacgacctca tcgccgaatt cgacgcgcgc        60
     aacgccgagc gcatcgatac gcctgtcatc cagccggccg aacctttcct tgatatcgcc       120
     ggcgaggatc tgcgccgccg catcttcatg acggagagcg aaaccggcgc cagcctctgc       180
     ctacgtcccg aattcaccat ccccgtctgt ctgcgccaca tcgagacggc gaccggcacg       240
     ccgaagcgtt atgcctatct cggcgaggtt ttccgccagc gccgcgacgg cgccaatgaa       300
     ttctatcagg ccggcatcga ggatcttggc gatatcgacc tgtcaaacgc cgacgcccgc       360
     gccatcggcg atgccaccgg cattctcgcc cgcctgctgc cgggccgccg cttagccgtg       420
     acattgggcg accaggcagt gttcgaggct gtcgtccagg cgctcggcct gccgctcggc       480
     tggcagaagc gcctgatcca cgccttcggc aatatgacgc agctggaagc cctgcttgcc       540
     agcctcgtca gcccgcaatt cgtcaccggg ctggacgacg atatcgccag gcttgtcgca       600
     tcagacgacg agcaggcgct ggtcgcctat ctcgagcggg agatgcagaa gaccggctat       660
     tcgacgaatg ccggccgctc ggccctggag atcgcccgaa ggctcaagga aaagctcatc       720
     ctgtccgaaa cgcgcctcga cgatgcggcc ttccgtgttt tggaagagtt cctgtcgctc       780
     gacgtgccgc ttatcaatgc ttccgcagcc ctttccggtt ttgccgatgc tgccggcctg       840
     aaactcggca acgcgctcgc ccgcttcaat ggccgcgttg cagcactttc caatgccggc       900
     gtcgatcttt cctgcctcga ctaccgcgcc gccttcggac ggccgctcga ctattacacc       960
     ggcctcgtct tcgaggtgac ggtggaaggc tcgaccgcgg tgctcgccgg cggcggccgc      1020
     ttcgaccggc tcctgacctt cctgggtgcg acggaccgta ttccggccgt cggcttctcc      1080
     ttctggctcg accgcatcga aaccgaaagg gcagccgcat ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page