(data stored in ACNUC7421 zone)

EMBL: CP001622.PE504

CP001622.PE504       Location/Qualifiers
FT   CDS_pept        531839..532534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0511"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: ret:RHE_CH00823 ATP phosphoribosyltransferase
FT                   catalytic subunit; TIGRFAM: ATP phosphoribosyltransferase;
FT                   PFAM: ATP phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54816"
FT                   /db_xref="GOA:C6B2J6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J6"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ACS54816.1"
FT                   /translation="MTITIALPSKGRMKEDASAIFERAGMTISAVGNDRSYRGRVEGWD
FT                   DVEIAFLSASEISREIGNGTVDFGVTGEDLMREGFAEVDKRVEFCARLGFGHADVVVAV
FT                   PEIWLDVDTMADLVDVAADFRARHSRRLAIATKYWRLTQQFFSSQHGIQLYRIVESLGA
FT                   TEGAPASGSADIIVDITSTGSTLRANHLKVLQDGVILHSQACLVRARKESHAGEPAVQA
FT                   IIDAVRAAL"
     atgaccatca ccatcgcgct tccctccaag ggccggatga aggaggacgc ttcggcgatc        60
     ttcgaacgtg ccggcatgac gatctcggct gttggcaacg atcgctccta tcgcggccgc       120
     gtcgaaggct gggacgatgt ggaaatcgcc ttcctttcgg cgtccgaaat ctcccgcgaa       180
     atcggcaacg gcacggtcga tttcggcgtt accggcgagg atctgatgcg ggaaggtttt       240
     gccgaggtcg acaagcgcgt cgaattctgc gcccgcctcg gcttcggcca cgccgatgtc       300
     gtcgtcgccg tgccggagat ctggctcgat gtcgacacca tggccgatct cgtcgacgtc       360
     gcggccgatt ttcgcgcccg ccactccagg cgccttgcca tcgccaccaa atactggcgg       420
     ctgacccagc agttcttttc gagccagcac ggcatccagc tgtatcgcat cgtcgaaagc       480
     ctgggcgcca ccgagggcgc tcccgcctcc ggctcggccg atatcatcgt cgatatcacc       540
     tccaccggct cgacgctgcg cgccaaccat ctgaaggtgc tccaggacgg cgtcatcctg       600
     cattcgcagg cctgcctcgt gcgcgcccgc aaggaaagcc acgccggcga acccgctgtg       660
     caggcgatca tcgatgcggt gcgtgccgcc ctctga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page