(data stored in ACNUC7421 zone)

EMBL: CP001622.PE505

CP001622.PE505       Location/Qualifiers
FT   CDS_pept        complement(532614..533030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0512"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: ret:RHE_CH00824
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54817"
FT                   /db_xref="GOA:C6B2J7"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J7"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACS54817.1"
FT                   /translation="MSNNVIILIARILLSFMFILSGFMKLTDPAGTAGMIAGAGLPAAT
FT                   LLAYVAGLFELLAGLAVLTGLQVRIAGWLLAAFCVFTGIAFHLPYASGTELVNILNQIM
FT                   VMKNITLAGAYILLATVGAGAYSLDARRGAYATA"
     atgtcgaaca acgtcatcat cctgattgcc cgtattcttc tttccttcat gttcatcctt        60
     tccggcttca tgaagctcac cgatcctgcc ggtactgcgg gcatgatcgc cggtgccggc       120
     ctgccggcag caaccctgct ggcctatgtc gcaggccttt tcgaactgct ggccggcctt       180
     gcggttctca caggcctcca ggtccgcatt gccggctggc tgctcgccgc cttctgtgtc       240
     ttcacgggca ttgccttcca cctgccctac gcgagtggca cggaactcgt gaacattctc       300
     aaccagatca tggtcatgaa gaatatcacg ctggccggcg cgtacatact gctcgccacc       360
     gtcggtgccg gcgcctactc gctcgacgcc cggcgcggcg cctacgcaac cgcctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page