(data stored in ACNUC7421 zone)

EMBL: CP001622.PE506

CP001622.PE506       Location/Qualifiers
FT   CDS_pept        533345..534055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0513"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ret:RHE_CH00825 glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54818"
FT                   /db_xref="GOA:C6B2J8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J8"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACS54818.1"
FT                   /translation="MADLSAFPITTRWPAKNPDIIQLYSLQTPNGVKVSVALEELGLAY
FT                   EPHYISFAANDQKSPEFESLNPNGRIPAIIDPNGPDGKPIGLFESGAILLYLAEKTGKL
FT                   IPADAAGRYETIQWVFFQMAGIGPMFGQFGHFHKFAADKVANNSYPVERYRDESKRLLG
FT                   VLDDRLKGRQWIMGDQYTIADITTFTWVRGADIFYGGREVLEYAKFPAVSDWLERCIAR
FT                   PASARGLNIPVKPE"
     atggcagatc tttccgcatt tccgatcacg acgcgctggc cggcaaaaaa tcccgacatc        60
     atccagctct attccctgca gacgccgaat ggggtgaagg tctcggtcgc cctcgaagag       120
     ctcggcctcg cctatgagcc gcattacatt tccttcgccg ccaacgatca gaagtcgccg       180
     gaattcgaat ctctcaaccc gaacggccgc attccggcga tcatcgatcc gaacggtccg       240
     gacgggaagc cgatcggcct tttcgagtcc ggcgcgatcc tgctttatct cgccgaaaaa       300
     accggcaagc tcatccctgc tgatgccgcc ggtcgctacg aaaccatcca gtgggtgttt       360
     ttccagatgg cgggtatcgg cccgatgttc ggccagttcg ggcatttcca taaattcgcc       420
     gccgacaagg tcgccaacaa ttcctatccg gtcgagcgtt atcgcgatga atccaaacgg       480
     ctgctcggcg tgctcgatga ccggctgaag ggtcgtcaat ggatcatggg cgatcaatac       540
     acgatcgccg acatcaccac cttcacctgg gttcgcggcg ccgatatttt ctatggcggc       600
     cgcgaggtgc tcgaatacgc aaaattcccc gccgtctcgg attggctgga gcgctgcatc       660
     gcccgcccgg caagtgccag gggactcaac ataccggtca agccggagta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page