(data stored in ACNUC7421 zone)

EMBL: CP001622.PE507

CP001622.PE507       Location/Qualifiers
FT   CDS_pept        complement(534119..534565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54819"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2J9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000912"
FT                   /protein_id="ACS54819.1"
FT                   /translation="MFKIARANAAVPLTPGSFDDANQNHEMLAQFSVSEAWTGDFSSGM
FT                   LRLGEWSAMLHGLAARECGLLSLIRCYDAKDRSHILELFEQAATLCSSFCFSTTIIMPN
FT                   GLRQPLFCMGESNGLEQKYSGSMVGVFVFPRFKLEGTKQITSRR"
     ttgtttaaga tcgccagagc caatgcagcc gtacctttga cacccggctc gtttgatgac        60
     gccaatcaaa atcacgagat gttggcgcag ttttccgttt ccgaagcttg gactggagat       120
     ttttcgagcg gcatgctccg tctcggcgaa tggagcgcga tgctgcacgg ccttgccgca       180
     cgggaatgcg gactgctcag cctgatccgc tgctatgatg ccaaggaccg cagccacata       240
     ttggagctgt tcgagcaggc ggcgacgctc tgctcctcct tctgtttttc gacgacgatc       300
     atcatgccga acggcttgcg ccagccgctg ttctgcatgg gcgagtccaa cggtctcgag       360
     cagaaataca gcggcagcat ggtcggcgtc ttcgtctttc cgcgcttcaa gctggaaggc       420
     acaaagcaga tcacaagccg gcgatag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page