(data stored in ACNUC7421 zone)

EMBL: CP001622.PE508

CP001622.PE508       Location/Qualifiers
FT   CDS_pept        complement(535298..536941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0515"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: ret:RHE_CH00828 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54820"
FT                   /db_xref="GOA:C6B2K0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K0"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACS54820.1"
FT                   /translation="MASKEIKFGRTAREKMLRGVDILADAVKVTLGPKGRNVIIDKSFG
FT                   APRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGN
FT                   KAVAAGMNPMDLKRGIDLAVADVVKDLQAKAKKISTSEEVAQVGTISANGDKQVGLDIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMIADLEDVFILL
FT                   HEKKLSNLQSMLPVLEAVVQTGKPLLIVAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSISKENTTIVDGSGAKT
FT                   DIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGSTEVEVKEKKDRIDDA
FT                   LNATRAAVQEGIVPGGGIALLRSSTKITVKGANDDQEAGINIVRRALQSLVRQIAENAG
FT                   DEASIVVGKVLDKNEDNYGYNAQTSEYGDMIAMGIVDPLKVVRTALQNAASVASLLITT
FT                   EAMIAELPKKESAGGGMPGGMGGMGGMDMM"
     atggcatcta aagaaatcaa gtttggccgc accgcgcgcg aaaagatgct gcgcggcgtc        60
     gacattctcg ccgatgcagt gaaggtcacg ctcggcccga agggccgtaa cgtcatcatc       120
     gacaagtcct tcggcgcgcc gcgcatcacc aaggacggcg tttccgtcgc caaggaaatc       180
     gaactcgaag acaagttcga aaacatgggc gcccagatgg tccgcgaagt tgcttcgaag       240
     accaacgaca tcgccggcga cggcaccacg acggctaccg ttcttgccca ggcgatcgtt       300
     cgcgaaggca acaaggccgt tgcagccggc atgaacccga tggacctgaa gcgcggcatc       360
     gaccttgctg ttgccgacgt cgtgaaggat ctccaggcca aggccaagaa gatctcgact       420
     tcggaagaag ttgcacaggt cggcacgatt tcggccaatg gcgacaagca ggtcggtctc       480
     gacattgctg aagccatgca gaaggtcggc aacgaaggcg tcatcacggt tgaagaagcc       540
     aagaccgccg aaaccgaact cgaagtcgtc gaaggcatgc agttcgaccg cggctacctc       600
     agcccctact tcgtgaccaa tccggaaaag atgatcgccg acctcgaaga cgtcttcatt       660
     ctccttcacg agaagaagct ctcgaacctg cagtcgatgc tcccggttct cgaagccgtc       720
     gttcagaccg gcaagccgct cctcatcgtc gctgaagacg tcgaaggcga agccctcgct       780
     acgctcgtcg tcaacaagct gcgcggcggc ctgaagattg ctgccgtcaa ggcacctggc       840
     ttcggcgatc gccgcaaggc catgctcgaa gacatcgcca tcctgacggg cggcactgtc       900
     atctccgaag atctcggcat caagctcgaa tccgtcacgc tcgacatgct cggccgtgcc       960
     aagaaggttt cgatctccaa ggaaaacacc acgatcgtcg acggttcggg cgctaagacc      1020
     gacatcgaag gccgtgttgc ccagatcaag gcccagatcg aagaaaccac ctccgactac      1080
     gaccgcgaga agctgcagga acgtcttgcc aagctcgctg gcggcgttgc cgtcatccgc      1140
     gtcggcggct cgacggaagt cgaagtgaag gaaaagaagg accgcatcga cgacgcgctc      1200
     aacgcgaccc gcgctgccgt tcaggaaggt atcgtccccg gcggcggtat cgctctgctc      1260
     cgctcctcca cgaagatcac cgtcaagggt gcaaacgacg accaggaagc cggcatcaac      1320
     atcgttcgcc gcgccctgca gtcgctcgtt cgtcagatcg ctgaaaacgc aggcgacgaa      1380
     gcctcgatcg ttgtcggcaa ggtcctcgac aagaacgaag acaactacgg ctacaacgcc      1440
     cagacgtccg aatatggcga catgatcgcc atgggtatcg tcgacccgct caaggtcgtt      1500
     cgcacggcgc tgcagaacgc tgcttctgtc gcatcgctgc tgatcaccac cgaagccatg      1560
     attgccgaac tgccgaagaa agaatcggct ggcggcggca tgccgggcgg aatgggcgga      1620
     atgggcggaa tggacatgat gtga                                             1644
//

If you have problems or comments...

PBIL Back to PBIL home page