(data stored in ACNUC7421 zone)

EMBL: CP001622.PE509

CP001622.PE509       Location/Qualifiers
FT   CDS_pept        complement(537014..537310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0516"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: smd:Smed_6083
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54821"
FT                   /db_xref="GOA:C6B2K1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K1"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACS54821.1"
FT                   /translation="MASTNFRPLHDRVVVRRVESEAKTKGGIIIPDTAKEKPQEGEIVA
FT                   VGSGARDESGKVVALDVKAGDRILFGKWSGTEVKIDGEDLLIMKEADIMGIIG"
     atggcaagca ccaacttccg cccccttcac gaccgcgtcg ttgttcgccg cgttgagtcc        60
     gaagccaaga ccaagggcgg catcatcatt cccgataccg ccaaggaaaa gccgcaggaa       120
     ggcgaaatcg tcgccgtcgg ctccggcgcg cgcgatgagt ccggcaaggt cgtcgcactc       180
     gacgtcaagg ctggcgaccg catcctgttc ggcaagtggt ccggcaccga agtcaagatc       240
     gacggcgaag accttctgat catgaaggaa gccgacatta tgggcatcat cggctga          297
//

If you have problems or comments...

PBIL Back to PBIL home page