(data stored in ACNUC7421 zone)

EMBL: CP001622.PE51

CP001622.PE51        Location/Qualifiers
FT   CDS_pept        complement(53662..54165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0052"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: ret:RHE_CH00392
FT                   lipoprotein signal peptidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54363"
FT                   /db_xref="GOA:C6AYD9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD9"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACS54363.1"
FT                   /translation="MTEQTHARPALFSRPAPILFFIVVAVLIDQAVKIAVDHYLPLQEA
FT                   VPVVPMLALYRTYNLGVAFSMLSGMDGWFIVGMRLIIVAFVIWLWYRTAKDRWIAHLGY
FT                   ALIIAGAIGNLVDRFAYGHVIDYILFYTESWSFAVFNLADSFITIGAGCVILDELLLPK
FT                   KASR"
     atgaccgaac agacgcatgc acgcccggcg ctgttttcgc gcccggcgcc gatcctcttc        60
     ttcatcgtcg tcgccgttct catcgaccag gccgtcaaga tcgccgttga tcattacctg       120
     ccgctacagg aggccgtacc cgtcgttccg atgctggcgc tctaccgcac ctacaatctc       180
     ggcgtcgcct tttcgatgct gtcgggcatg gacggctggt tcatcgtcgg catgcggctc       240
     atcatcgtcg ccttcgtcat ctggctgtgg taccgcacgg cgaaggatcg ctggatcgcc       300
     catctcggtt atgcgctgat catcgccggc gcgatcggca atctcgtcga ccgcttcgct       360
     tatgggcatg tgatcgatta cattctattc tacaccgaga gctggtcctt cgcggtcttc       420
     aatctcgccg acagtttcat caccatcggg gccggctgcg tcattctcga cgagctgctg       480
     ctgccgaaaa aggccagccg ctaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page