(data stored in ACNUC7421 zone)

EMBL: CP001622.PE510

CP001622.PE510       Location/Qualifiers
FT   CDS_pept        537705..538553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0517"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   HAD-superfamily subfamily IIA hydrolase like protein; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   ret:RHE_CH00830 putative hydrolase, haloacid
FT                   dehalogenase-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54822"
FT                   /db_xref="GOA:C6B2K2"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K2"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACS54822.1"
FT                   /translation="MAKRIENFSEISGRYDVVLCDVWGVVHNGVDPFPKAAAALEAARE
FT                   NGLAVVLITNSPRLSWQVVDQLRQIGVPDSAYDRIVTSGDVTRGLIAEGPKTVFLLGPE
FT                   RDKALLEGIGVERRPAGEAQSLVCTGFFDDETEKPEDYTDMLLDFKARDVPMICANPDL
FT                   IVERGHRIIPCAGAMAAYYEQLGGKTRIAGKPHRPIYEATLAAARELRGDFPVDRVLAI
FT                   GDGMPTDVRGALNYGLDLLYISGGIHAKEYTLNGETDEAILNAYLERENAAPKWWMPRL
FT                   A"
     atggctaagc ggatagaaaa cttctcggag atatcaggtc gctatgatgt ggtgctctgc        60
     gatgtctggg gcgtcgttca caacggcgtc gatccgttcc cgaaggcggc cgcagccctt       120
     gaagcggcac gcgaaaacgg cctcgccgtt gtcctcatca ccaattcgcc gcgcctttcc       180
     tggcaggtgg tcgatcagtt gcgccagatc ggcgttcccg acagtgccta tgacaggatc       240
     gtcacctctg gcgacgtcac gcgcgggctg atcgccgaag ggccgaagac cgtctttctg       300
     ctcggccccg agcgcgacaa ggcgctgctc gaaggcattg gcgtcgagcg ccggccggcg       360
     ggcgaagcgc aatcgctggt ctgcaccggc tttttcgacg acgagaccga gaagccggag       420
     gattacaccg acatgcttct cgatttcaaa gcccgcgacg tgccgatgat ctgcgccaat       480
     cccgacctca tcgtcgagcg cggccatcgc atcatccctt gcgccggcgc catggccgcc       540
     tattacgagc agctcggcgg caaaacccgc atcgccggca agccgcaccg gccgatctac       600
     gaggcgacgc ttgcggctgc ccgcgagctt cgcggcgatt tcccggtcga tcgcgtgctg       660
     gcgatcggcg acggcatgcc gaccgacgtg cgcggcgcct tgaattacgg cctcgacctc       720
     ctctacatca gcggcggtat ccacgctaag gaatatactc tcaacggcga gaccgacgag       780
     gcgatcctca acgcctatct cgaacgggaa aacgccgcgc cgaagtggtg gatgccccgc       840
     cttgcatga                                                               849
//

If you have problems or comments...

PBIL Back to PBIL home page