(data stored in ACNUC7421 zone)

EMBL: CP001622.PE511

CP001622.PE511       Location/Qualifiers
FT   CDS_pept        538585..539568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0518"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG:
FT                   rec:RHECIAT_CH0000917 riboflavin kinase/FMN
FT                   adenylyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54823"
FT                   /db_xref="GOA:C6B2K3"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K3"
FT                   /inference="protein motif:TFAM:TIGR00083"
FT                   /protein_id="ACS54823.1"
FT                   /translation="MTVFHRNETREPLPAHLKGGVIAIGNFDGVHRGHQSVLSRALEIS
FT                   KARGIPALVLTFEPHPRTVFRPQTPVFRLTPAPLKARILETLGFSAVIEYPFDYEFSQR
FT                   SADDFIHSILKDWLGASEVVTGFDFHFGRGREGGPAFLMNAGHTYGFGVTLIDAFRDEN
FT                   ADVVSSSHIRALLKEGNVSEVAGMLGYRYTVEAEVIDGEKLGRQLGFPTANMRLPPEVD
FT                   LAAGIYAVRFRRQDGTLHDAVASYGRRPTVTENGAPLLETYLFDFSGDLYGQLCSVSFF
FT                   GYLRPELKFDGLDPLVAQIKRDEEEARALLAGVKPLGALDRKLCFS"
     atgaccgtct tccaccgcaa tgaaacccgg gaacccctac ccgcccatct aaagggcggc        60
     gtcattgcca tcggcaattt cgatggcgtg caccgcggcc atcaatcggt gctgagccgg       120
     gcgctcgaga tctccaaggc gcgcggtatc cccgctttgg tgctgacatt cgagccgcat       180
     ccgcgcacgg tcttccggcc gcagacaccg gtcttccgcc tgacgccggc gccgctgaaa       240
     gcccgtatcc tggaaacgct gggcttcagc gccgtcatcg aatatccctt cgactacgaa       300
     ttctcgcagc gctcggccga tgatttcatc cattcgatcc tgaaggattg gctcggcgct       360
     tccgaagtgg tcaccggctt cgatttccat ttcggccgtg gccgcgaggg cggtccggcc       420
     ttcctgatga atgccggcca tacctacggc ttcggcgtca ccctgatcga tgccttccgt       480
     gacgaaaacg ccgatgtcgt ctcttcgagc catatccgcg cgctcctgaa ggagggcaat       540
     gtcagtgaag tcgccggcat gctcggttac cgctatacgg tggaagccga ggtgatcgat       600
     ggcgaaaagc tcggccgcca actcggtttt ccgacggcca acatgcgcct gccgccggag       660
     gtcgatcttg ccgccgggat ctacgccgtc cgcttccgcc gccaggacgg cacgctccac       720
     gatgccgttg caagctatgg ccgccgcccg acggtcacgg aaaacggcgc gccgctgctg       780
     gaaacctatc ttttcgattt cagcggcgat ctctacggcc agctctgctc cgtctccttc       840
     tttggttatc tccgccccga gctgaaattc gacggcctcg atccgctcgt cgcccagatc       900
     aagcgcgatg aggaagaggc gagggcgctg cttgcgggtg tcaagccact cggcgcgctt       960
     gatcggaaac tgtgcttttc ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page