(data stored in ACNUC7421 zone)

EMBL: CP001622.PE512

CP001622.PE512       Location/Qualifiers
FT   CDS_pept        539856..542747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0519"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   rec:RHECIAT_CH0000920 isoleucyl-tRNA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54824"
FT                   /db_xref="GOA:C6B2K4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K4"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACS54824.1"
FT                   /translation="MTDTAEKIDYSKTLYLPETDFPMRAGLPQKEPELVKRWQEMGLYK
FT                   KLRASAAGREKFVLHDGPPYANGNIHIGHALNKILKDVINRSFQMRGYDANYVPGWDCH
FT                   GLPIEWKIEEKYREKGKNKDEVPVNEFRRECREFAAGWIKVQAEEFKRLGIEGDFDNPY
FT                   TTMNFHAESRIAGELLKIAASGQLYRGSKPIMWSVVERTALAEAEVEYQDYESDTIWVK
FT                   FPVVEGPVALKDAFVVIWTTTPWTIPGNRAVSFSPRISYGLYEVTAAENDFGPRPGEKL
FT                   IFADKLAEESFAKAKLQYKRLSDVSAADFAAMTCAHPFKGLGGGYEFRVPLLDGDHVTD
FT                   DAGTGFVHTAPSHGREDFDAWMSAVRALEARGIDTKIPFPVDDGGFYTSDAPGFEGARV
FT                   IDDNGKKGDANDRVIRELIARGALFARGRLKHQYPHSWRSKKPVIFRNTPQWFVYMDKT
FT                   LADGTTLRSRALGAIDDTRFVPAAGQNRLRAMIEGRPDWVLSRQRAWGVPIAVFADDDG
FT                   DVLVDEAVNARILEAFEHEGADAWFAEGAKERFLGNDHDHSRWTQVMDILDVWFDSGST
FT                   HTFTLEDRPDLKWPADLYLEGSDQHRGWFHSSLLESAATRGRAPYNAVLTHGFTMDEKG
FT                   EKMSKSKGNVTAPQEVMKDAGADILRLWVMTSDYADDLRVGKTIIQTNVDAYRKLRNTI
FT                   RWMLGTLAHDKGEEIALADLPELEQLMLHRLAELDELVRENYDAFDFKKIARALIDFAN
FT                   VELSAFYFDVRKDALYCDAPSSLRRRASLHVIRQIFDCMVTWLAPMLPFTTEEAWLSRN
FT                   PSAVSVHLEQFAPVAKEWRNDALAEKWKKIRTVRSVVTGALEIERKDKRIGSSLEAAPV
FT                   VHIADPELLKALEGQDFTEVCITSAIEIKVGEGPGDAFRLAEVPQVSVVPKLAEGEKCA
FT                   RSWRITRDVGSDPEYPDVSARDAAALRELAALT"
     atgaccgata cagccgaaaa gatcgactat tcgaagaccc tctatttgcc cgagaccgat        60
     tttcccatgc gcgccggcct gccgcagaag gaaccggaac tcgtcaagcg ctggcaggag       120
     atgggtctct acaagaaact gcgcgcttcc gccgccggcc gcgagaaatt cgtccttcac       180
     gatggccctc cctatgccaa cggcaacatc catatcggcc atgcgctgaa caagatcctc       240
     aaggacgtca tcaaccgttc gttccagatg cgcggctacg acgccaatta cgtgcccggc       300
     tgggattgcc acggcctgcc gatcgaatgg aagatcgaag agaagtaccg cgagaagggc       360
     aagaacaagg acgaggtccc ggtcaacgaa ttccgccggg aatgccgtga attcgccgcc       420
     ggctggatca aagtccaggc ggaagagttc aagcgcctcg gcatcgaggg cgacttcgac       480
     aatccctata cgacgatgaa ttttcacgcg gaatcgcgca tcgccggcga actcttgaag       540
     atcgccgcaa gcggtcagct ttatcgcggc tccaagccga tcatgtggtc ggtcgtcgag       600
     cgcacggcgc tggcagaggc cgaggtcgaa taccaggact atgagagcga cacgatctgg       660
     gtgaaattcc cagtcgtcga aggtccggtc gcgctcaagg atgcgttcgt ggtcatctgg       720
     acgaccacgc cctggacgat ccccggcaac cgcgcggtct ccttttcgcc gcgcatctcc       780
     tacggcctct atgaagtgac ggccgccgag aacgattttg gtccgcgtcc cggcgaaaag       840
     ctgatctttg ccgacaagct ggccgaggaa tccttcgcca aggccaagct gcagtataag       900
     cgcttgagcg atgtctctgc agccgacttc gcagcgatga cctgtgccca tcccttcaag       960
     ggtctcggcg gtggctatga attccgcgtg ccgctgctcg atggcgatca cgtcaccgat      1020
     gacgccggca ccggcttcgt gcacaccgca cccagccacg gtcgggaaga cttcgatgcc      1080
     tggatgtcgg ctgtccgcgc gcttgaggcc cgcggcatcg acaccaagat cccgtttccg      1140
     gtcgacgacg gcggcttcta cacatcagac gcccccggct tcgagggcgc ccgcgtcatc      1200
     gacgacaacg gcaagaaggg cgatgccaac gaccgtgtca tcagggaact gatcgcccgc      1260
     ggcgcgctct ttgcccgcgg ccggctgaag caccagtatc cgcattcctg gcgctcgaag      1320
     aagccggtca tcttccgcaa cacgccgcaa tggttcgtct atatggacaa gacccttgcc      1380
     gacggcacga cgctgcgttc gcgcgcgctg ggtgcgatcg atgatacgcg cttcgtgccc      1440
     gccgccggcc agaaccgcct gcgcgccatg atcgaaggcc gtcctgactg ggtgctctcg      1500
     cgccagcgcg cctggggcgt gccgatcgcc gtctttgcag acgatgatgg cgatgtcctg      1560
     gtcgacgaag ccgtcaacgc ccgcatcctc gaagccttcg aacatgaggg cgccgacgcc      1620
     tggtttgccg aaggcgccaa ggagcgtttc ctcggcaatg accacgacca ttcccgctgg      1680
     acccaggtca tggatatcct cgacgtctgg ttcgactctg gctcgacgca caccttcacg      1740
     ctcgaagacc gcccggacct gaagtggccg gccgatcttt atctcgaggg atccgaccag      1800
     catcgcggct ggttccattc gtcgctgctg gaatcggcgg ccactcgcgg ccgcgcgcct      1860
     tataacgccg tcctcaccca tggcttcacc atggacgaga agggcgagaa gatgtcgaag      1920
     tcgaagggca acgtcacagc acctcaggaa gtgatgaagg acgccggtgc cgatatcctg      1980
     cgcctctggg tgatgacctc ggattatgcc gacgacctgc gcgtcggcaa gacgatcatc      2040
     cagaccaatg tcgatgccta tcgcaagctg cgcaacacca tccgctggat gctcggcacg      2100
     ctcgcccacg acaagggcga ggagatcgcg cttgccgacc tgccggagct ggagcagctg      2160
     atgctgcacc ggctggccga gctcgacgag ctggtgcgcg agaactacga tgccttcgac      2220
     ttcaagaaga tcgcccgcgc gctgatcgat ttcgccaatg tcgagctttc ggccttctat      2280
     ttcgatgtcc gcaaggatgc gctctattgc gacgcgccgt cgagcctgcg ccggcgcgcc      2340
     agcttgcacg tcatccgcca gatcttcgat tgcatggtga cgtggcttgc cccgatgctg      2400
     cccttcacca ccgaggaggc ctggctgtcg cgcaacccgt ccgccgtttc ggtgcatctg      2460
     gagcagtttg ccccggtcgc aaaggaatgg cgcaacgatg ccctggccga gaagtggaag      2520
     aagatccgca ccgtccgctc ggttgtgaca ggcgctctgg agatcgagcg caaggacaag      2580
     cgcatcggct cctcgctgga agcggctccc gtcgttcata tcgccgatcc ggaactgctg      2640
     aaggcgttgg aaggccagga cttcaccgag gtctgcatca cctcggcaat cgagatcaag      2700
     gtcggcgaag gaccagggga tgctttccgc ctggcggagg tgcctcaggt cagcgtcgtg      2760
     ccgaagcttg cagagggtga gaaatgtgcc cgctcctggc gcatcaccag ggatgtcggt      2820
     tccgatcccg aatatcccga tgtttcggcc cgcgacgctg ctgcccttcg tgagcttgcc      2880
     gcacttacgt ga                                                          2892
//

If you have problems or comments...

PBIL Back to PBIL home page