(data stored in ACNUC7421 zone)

EMBL: CP001622.PE513

CP001622.PE513       Location/Qualifiers
FT   CDS_pept        542881..543510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54825"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K5"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000921"
FT                   /protein_id="ACS54825.1"
FT                   /translation="MLATHWFRMGACLSVVVAGCSLVSGCASSPTYGTDKTAMEQLTDD
FT                   LGQSVSLTGPDPKNKGVKYTPRPTLVLPAQAQKETLVAPQQTVANKDNPQWLESPEETR
FT                   ARLVSEADANEDNPNYRSPLASSAIEGGRRTTEAQTKAYREARALQKGSYVDQRRYISD
FT                   PPPGYRTVDDPAKLDDVGEPELKKQKKRKKDAAVANTGKQWWNLLQ"
     atgttagcaa cgcattggtt ccgtatgggc gcctgcctgt ctgttgtagt ggcgggatgc        60
     tccctggtgt ccggttgcgc cagcagcccg acctacggca ccgacaagac cgccatggag       120
     cagctgaccg acgatctcgg ccagtcggtg tctttgaccg gtccagaccc gaagaacaaa       180
     ggcgtcaagt acacgccgcg tccaacgctg gtgctgccgg ctcaggcgca gaaagagacc       240
     ctcgttgcgc cgcagcagac ggtcgccaac aaggacaatc cgcagtggct tgaatcgccg       300
     gaggagaccc gtgctcgtct cgtttcggaa gccgacgcga acgaggacaa tccgaattac       360
     cgctcgccgc tcgcaagctc tgcgatcgaa ggcggccggc gcacgacgga agctcagacc       420
     aaggcctacc gtgaagcccg cgccctgcag aagggctcct atgtcgatca gcgccgctat       480
     atatccgatc cgccgcccgg ctaccgcact gtcgacgatc cggcaaaact cgatgatgtc       540
     ggcgagcccg aactcaagaa gcagaagaag cgcaagaagg atgcagccgt cgccaacacc       600
     ggcaagcagt ggtggaacct cctgcaatag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page