(data stored in ACNUC7421 zone)

EMBL: CP001622.PE514

CP001622.PE514       Location/Qualifiers
FT   CDS_pept        complement(543564..544001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0521"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rec:RHECIAT_CH0000922 cytosine deaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54826"
FT                   /db_xref="GOA:C6B2K6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K6"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACS54826.1"
FT                   /translation="MEMALEEARAAGERGEVPIGAVVVIDDIAVSRSGNRTRELKDVTA
FT                   HAEIAAIRLACEALGQERLAGADLYVTLEPCTMCAAAISFARIRRLYYGAEDPKGGGVD
FT                   NGVRFYGQPTCHHAPEVYSGFNEVQSANLLRRFFSQRREAP"
     atggagatgg cgctcgaaga agcgcgtgcc gccggagaac gcggagaggt gccgatcggc        60
     gccgtcgtcg ttatcgacga tattgccgtt tcacgctctg gaaaccgcac gcgcgagctc       120
     aaagacgtca ccgcacacgc cgaaatcgcc gcgattcggc tcgcctgcga agcgctcgga       180
     caggaacgtc ttgccggcgc cgatctctac gtgacgctgg agccttgcac catgtgcgcg       240
     gcagccatct cgtttgcgcg catccgcagg ctctactacg gcgccgagga cccgaagggc       300
     ggcggcgtcg acaatggcgt gcgattctat gggcagccga cctgccacca cgccccggag       360
     gtctattccg gcttcaacga ggtccaatcg gccaatctgc tgcgaaggtt cttttcgcaa       420
     aggagagagg caccgtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page