(data stored in ACNUC7421 zone)

EMBL: CP001622.PE515

CP001622.PE515       Location/Qualifiers
FT   CDS_pept        544092..546188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0522"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase; SMART: RNA-binding S4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000923 probable RNA-pseudouridine synthase
FT                   protein, ribosomal large subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54827"
FT                   /db_xref="GOA:C6B2K7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K7"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACS54827.1"
FT                   /translation="MTPKDKPKRPGAKPLSRDIRSKAGPKADGDKPAKPAVARAIAAET
FT                   DSDAKAERISKVMARAGVASRRDIERMIMEGRVTLNGRVLDTPVVNVTLADRIEVDGVP
FT                   IRGIERTRLWLYHKPTGLVTTNADPEGRSTVFDNLPEELPRVMSIGRLDINTEGLLLLT
FT                   NDGGLARALELPATGWLRRYRVRAHGEIDQDALDKLKDGIAVDGVLYGSIEATLDRTQG
FT                   SNVWITMGLREGKNREIKNVLGALGLDVNRLIRISYGPFQLGDLPESHVVEVRGRTLRD
FT                   QLGPRLIEEAKANFDAPIYNTTAVAAEEEAEPAAPEKRERPRRDEDKRERALSRLDTKR
FT                   DDRHGGARKEDDRRDGGRRDDEKPKRPQPLGQRRSANVWMAPGARPLGEKAAAKAAKNA
FT                   QTARRRGEQAPAKNDRIEDRPRTQVNRVREEDGEWIRSSEQPRGKDEGEGFGRKRGFGD
FT                   RPAREDRGSGDRPARGDRPFGDRPPRGDRPFGDKPRGDRKPRADGDERPRAARSPAGEG
FT                   RSERPRGDRPFGDRPSRGDRPFGDKPRGDRKPRADGDERPRAARTSPGEGRSERPRSDR
FT                   PSGDRPSRGDRPFGDKPRGDRRPREDGDERPRAARSFAGEGRSERPRGDKPSGDRPSGD
FT                   RPRGKGFAAKPSGAKPGGAKSFSGKPKGTKPGGDRPGGDRPAGGPSRGGAKGKGMTRGA
FT                   DRRR"
     atgacaccca aagacaagcc aaaacgcccg ggcgcaaagc ccctttcacg ggatatcagg        60
     tcgaaagccg gcccgaaggc ggacggcgac aagccggcaa agcctgcggt cgcacgcgca       120
     atcgccgccg aaaccgatag tgacgccaag gccgaacgca tttccaaggt gatggcgcgt       180
     gccggcgtcg cctcccgccg tgacatcgaa cgcatgatca tggaaggccg tgtgacgctg       240
     aacggcaggg tgctcgacac ccccgtcgtc aacgtcacgc tcgccgatcg catcgaagtc       300
     gacggcgtgc cgatccgcgg catcgagcgc accagactgt ggctctatca taagcccacc       360
     ggcctggtga ccaccaatgc cgatccggaa ggccgctcga ccgtcttcga caacctgccg       420
     gaagaattgc cgcgcgtcat gtcgatcggc cgcctcgata tcaacaccga gggcctgctg       480
     ctcttgacca atgacggcgg tctcgcccgc gcgctcgagc tgccggcgac cggctggctg       540
     cggcgttacc gtgtccgcgc ccatggcgag atcgatcagg acgcgctcga caagctgaag       600
     gacggcattg ccgtcgacgg cgtgctctac ggctcgatcg aggcgacgct cgaccgcacg       660
     cagggctcga acgtctggat caccatgggt cttcgcgaag gcaagaaccg cgaaatcaag       720
     aacgttctcg gtgcgctcgg cctcgacgtc aatcgcctga tccgcatttc ctatggcccg       780
     ttccagcttg gcgacctgcc ggaaagccat gtcgtcgaag tgcgcggccg cacactgcgc       840
     gaccagctcg gcccgcgcct catcgaggaa gccaaggcga atttcgacgc gccgatctac       900
     aatacgacgg cggtcgctgc cgaggaagag gcagagccgg cagcaccgga aaagcgcgag       960
     cgtccgcgtc gcgacgagga caagcgcgaa cgggcgctga gccgtctcga tacgaagcgc      1020
     gacgaccgcc acggtggggc gcgcaaagag gacgatcgcc gcgacggcgg ccgcagggac      1080
     gacgagaagc cgaagcgtcc ccagccgctc ggccagcgcc gcagcgccaa tgtctggatg      1140
     gcgccgggcg cccggccgct cggcgaaaag gcagcggcga aagccgccaa gaatgcgcag      1200
     actgcgcgcc ggcgcggcga gcaggcgccg gcaaagaatg atcgcatcga ggatcgcccg      1260
     cgcacgcagg tgaaccgcgt gcgcgaagag gatggcgaat ggatccgctc gagcgagcag      1320
     ccccgcggca aggatgaggg cgaaggcttc ggccgcaagc gcggctttgg tgatcgcccc      1380
     gcccgcgaag accgcggttc tggcgaccgc ccggcgcgcg gcgaccggcc gttcggtgat      1440
     cgtcccccgc gtggtgatcg gcccttcggc gacaagccgc gcggcgatcg caagccgcgt      1500
     gcggatggcg acgagcgtcc tcgtgccgcg agaagccctg ccggtgaggg ccgttctgag      1560
     cgtccgcgcg gcgaccgccc cttcggcgac cgtccttcgc gtggagaccg ccccttcggc      1620
     gacaagccgc gcggtgatcg caagccgcgt gcggatggcg acgagcgtcc tcgtgccgcc      1680
     agaacctccc ccggtgaggg ccgttctgag cgtccgcgca gcgaccgccc ctccggtgat      1740
     cgtccttcac gtggagaccg gcccttcggt gataagccgc gtggcgatcg caggccgcgc      1800
     gaggacggtg atgagcgtcc gcgggcagcc agaagctttg ccggcgaggg ccgctccgag      1860
     cgtccgcgcg gtgacaagcc ttcgggtgac aggccttctg gagacaggcc gcgcggcaag      1920
     ggctttgcgg ccaagcccag cggggcgaaa cctggtgggg ccaagagttt ttccggcaag      1980
     ccgaaaggca ccaagccggg cggggacaga ccgggcggcg acaggcctgc gggcgggccg      2040
     tccagaggtg gtgctaaagg aaaaggaatg acgcgcggtg cggatcgtcg gcggtga         2097
//

If you have problems or comments...

PBIL Back to PBIL home page