(data stored in ACNUC7421 zone)

EMBL: CP001622.PE516

CP001622.PE516       Location/Qualifiers
FT   CDS_pept        546169..546729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0523"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; KEGG: rec:RHECIAT_CH0000924
FT                   putative methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54828"
FT                   /db_xref="GOA:C6B2K8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K8"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ACS54828.1"
FT                   /translation="MRIVGGEFRGRPLAVPKSNEIRPTADRTRESLFNILSHAYPECVD
FT                   GTRILDLFAGTGAVGLEAVSRGCRHALFVENSVEGRALLWENIDALGLHGRTRILRRDA
FT                   TDLGSVGNLDPFDVLFADPPYGKGLGEKAMAAAVEGGWLRPGAIAVLEERADIVVSVHP
FT                   SYVFLESRIFGDTRVHFFRYQPQ"
     gtgcggatcg tcggcggtga gtttcgcgga cggcctctcg ccgtgccaaa atccaacgag        60
     atccggccga ctgccgaccg gacgcgcgag agtctgttca atatattgag ccatgcctat       120
     ccggaatgcg tcgatggcac ccggattctc gacctttttg ccggcaccgg cgccgtcggc       180
     ctcgaagcgg tttcacgcgg ctgtcgccat gcgctcttcg tcgaaaacag tgtcgagggc       240
     agggcgctgc tctgggagaa catcgatgcg ctcggcctgc atggccgcac gcgcatcctg       300
     cgccgggatg cgaccgatct cggcagcgtc ggcaatctcg accccttcga cgtgctcttt       360
     gccgacccac cctatggcaa gggtctcggc gaaaaggcga tggcggcagc ggtcgagggc       420
     ggctggctgc ggccaggcgc aatcgccgtg ctcgaagaac gggccgatat tgtcgtttcc       480
     gtccatcctt cctatgtctt cctcgaaagc cgcatctttg gcgatacgag ggtgcatttc       540
     ttccgatatc agccgcaata a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page