(data stored in ACNUC7421 zone)

EMBL: CP001622.PE517

CP001622.PE517       Location/Qualifiers
FT   CDS_pept        546742..547623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0524"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rec:RHECIAT_CH0000925 putative
FT                   hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54829"
FT                   /db_xref="GOA:C6B2K9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2K9"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACS54829.1"
FT                   /translation="MQQAEIISPKLPAISDVPTVAVAFGGGGARGLAHIHVIETLDELG
FT                   IRPVAVSGSSIGAIMAAGMAAGMSGAEIREHALTTVGNKTAVVARIWGLRPATVRDAVA
FT                   KGIRIGQFNLERILKAFLPSELPARFEDLLVPMKVITTDYYGQCEVIIEQGELFPALAA
FT                   SSAIPAVFMPVRLRDRVMIDGGISNPVPYECLMDLADIVVGIDVVGAPEGDGTHIPNRM
FT                   ESIFGSGQLMMQTAISLKLKLRPPHIFLRPTVGRTGVMDFLKAREVLAMSVGVKDDLKF
FT                   ALDREIEARLKR"
     gtgcagcagg cagagatcat cagcccgaaa ttgcctgcga tcagcgatgt gccgacggtc        60
     gccgtcgctt ttggcggcgg cggtgcgcgc ggacttgccc atatccatgt catcgagacg       120
     ctcgatgaac tcggcatccg cccggtggcg gtatcaggct cgtcgatcgg cgcgatcatg       180
     gcggccggca tggcggccgg catgtccggc gccgaaatcc gcgaacatgc gctgacgacc       240
     gtcggcaaca agacggccgt cgtcgcccgc atctggggcc tgaggccggc gacggtgcgc       300
     gatgcggtgg ccaagggtat ccgcatcggc cagttcaatc tggagcggat cctgaaagcc       360
     ttcctgccgt ccgagctgcc ggcccgcttc gaggatctgc tggtcccgat gaaggtgatc       420
     accacggatt attacgggca gtgcgaagtc atcatcgaac agggtgagct gttcccggcg       480
     ctcgcggcct cttccgccat ccccgccgtc ttcatgccgg tgcgcctgcg cgaccgcgtg       540
     atgatcgacg gcggcatcag caatccggtg ccctatgaat gcctgatgga tcttgccgac       600
     atcgtcgtcg gcatcgatgt cgtcggcgcg ccggaaggtg acggcacgca tattccgaac       660
     cgcatggaga gcatcttcgg ttccggtcag ctgatgatgc agacggcgat ctcgctgaag       720
     ctgaagcttc gcccgccgca tatcttcctg cgcccgaccg tcggccgcac cggcgtcatg       780
     gatttcctca aggcccgtga agtccttgcc atgtccgtcg gcgtcaagga cgacctgaaa       840
     ttcgcccttg accgggaaat cgaggctcgg ctgaagcgct ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page