(data stored in ACNUC7421 zone)

EMBL: CP001622.PE518

CP001622.PE518       Location/Qualifiers
FT   CDS_pept        complement(547636..548088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54830"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L0"
FT                   /inference="similar to AA sequence:KEGG:Avi_7626"
FT                   /protein_id="ACS54830.1"
FT                   /translation="MKKIIAIVAGVLLASMASADDDPQQAIPARLKVMFERPDKPLDIA
FT                   PVVVQGDWAIVGWRQDGRGGRALMKKTHHGWSIYLCSGDSLKDTATLETIGLSAVDAAG
FT                   LAAKLKNAEAGLDSSALALFSSFEGTMMMNEASNGAGHAGHEGHAQ"
     atgaagaaga tcatcgctat tgttgccggc gtgctgcttg catccatggc atctgcggac        60
     gatgatccgc aacaggcgat cccggcgagg ctgaaggtga tgttcgaacg gccagacaag       120
     ccgctcgata tcgcgccggt cgtcgttcag ggcgattggg cgatcgtcgg ctggcggcag       180
     gacggacgcg gcggacgggc cctgatgaaa aagacgcatc acggctggag catctatctc       240
     tgcagcggcg acagcctgaa ggataccgcg acgctggaga cgatcgggct ctccgcagtt       300
     gacgccgccg ggctggctgc gaaactgaag aatgccgagg ccggcctcga ttcttccgcg       360
     cttgcgctgt tctcaagctt cgagggcacg atgatgatga atgaggcttc aaacggcgcg       420
     ggtcatgccg gccatgaggg ccatgcccag tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page