(data stored in ACNUC7421 zone)

EMBL: CP001622.PE519

CP001622.PE519       Location/Qualifiers
FT   CDS_pept        complement(548102..549475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0526"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4;
FT                   PepSY-associated TM helix domain protein; KEGG: cysJ;
FT                   sulfite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54831"
FT                   /db_xref="GOA:C6B2L1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L1"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ACS54831.1"
FT                   /translation="MSTITAAEPAEHAADGVSLYRAIWRWHFFAGLLVIPFLLNLAVTG
FT                   SLYLFKDEINSTFFGYRYSVQPAGEALSPERIAEIAASAVPGSTATSYKDPVLPERSAI
FT                   VTLSSDAGSMLVFVNPYDGKVLDVVGSTDEFNYVVKRIHSLAYFGTITNRLIEIAGGFA
FT                   MVLVVTGIYLWWPRRQTGGVISVRGTPGRRVFWRDLHAVTGAFAGILIFFLAMSGMPWS
FT                   GYWGANANAWLTEHGLGYPVQLWGDVPKSRKVTEDILPNSGWIVEKAPVPLSDIAAAQS
FT                   ARPIGLEKAVETAKRLGMAPGFDLAIPSDETGVYTASLFPDDLADERTLHIDQYSGKPL
FT                   IDIGFDQYPFLGKAIEWGINVHQGQEWGRFNQLLMLATCLAIVLSCVTAIVMWWKRRPI
FT                   GRLGVPPMPPKPSIYYGLWVIVGIFAVTFPMSGLAIVAMIAFDQIVVRFVPLLKRVLA"
     atgtcgacca ttactgctgc cgaaccggcg gagcatgccg cagacggcgt ttcgctctac        60
     cgtgccatct ggcgctggca tttcttcgcc gggcttctcg tcataccctt cctgctcaat       120
     ctggccgtta ccggatcgct ctatctcttc aaggacgaga tcaacagcac cttcttcggc       180
     taccgctaca gtgtccagcc ggctggcgaa gcgctgtcgc cggagcggat cgcagagata       240
     gccgcctccg ccgtgccggg ctcaaccgcg acatcctaca aagacccggt cctgcccgag       300
     cgatcggcca tcgtcaccct ctccagcgat gccggctcga tgctggtctt tgtcaacccc       360
     tatgacggca aggtgctcga tgtggtcgga tcgaccgacg agttcaatta tgtcgtcaag       420
     cgcatccaca gcctcgccta tttcggcacc ataacgaacc ggctgatcga aattgccggc       480
     ggctttgcca tggtgctcgt cgtcaccggc atctatctct ggtggccgcg acgccagacg       540
     ggcggcgtta tcagcgtgcg gggaacgccc ggccgccgcg ttttctggcg cgacctgcat       600
     gcggtgaccg gtgccttcgc cggcatcctg atcttcttcc ttgcgatgtc aggcatgcca       660
     tggtcgggct attggggggc gaacgccaat gcctggctga ccgaacatgg cctcggctat       720
     ccggtccagc tctggggcga cgtgccgaag tcgcggaaag tcaccgagga tatccttccg       780
     aacagcggct ggatcgtcga gaaggcgccc gttccgcttt ccgatatcgc cgcagcgcaa       840
     tcagccaggc caatcggcct cgaaaaagcc gtggagaccg ccaaacggct gggcatggcg       900
     ccgggcttcg acctagcgat cccctccgac gagacgggcg tctataccgc ctcgctcttt       960
     cccgacgatc ttgccgacga acgcacgctc catatcgacc agtattccgg caaaccactg      1020
     atcgatatcg gcttcgatca atatccgttc ctcggcaaag cgatcgaatg gggcatcaat      1080
     gtccaccaag gacaggaatg ggggcgtttc aaccagttgc tgatgctcgc aacatgcctc      1140
     gcaattgtgc tcagttgcgt gaccgctatc gtcatgtggt ggaaacggcg cccgatcggc      1200
     cgcctcggcg tgccacccat gccgccgaag ccttcgatct attacggcct gtgggtgatc      1260
     gtcgggatct tcgccgtcac cttcccgatg agcgggctcg cgattgtcgc catgatcgcc      1320
     ttcgaccaga tcgtcgtgcg gttcgtaccg ttgctgaaac gtgttctcgc ttga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page