(data stored in ACNUC7421 zone)

EMBL: CP001622.PE52

CP001622.PE52        Location/Qualifiers
FT   CDS_pept        complement(54162..55022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0053"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O
FT                   ribose methyltransferase substrate binding; KEGG:
FT                   ret:RHE_CH00393 rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54364"
FT                   /db_xref="GOA:C6AYE0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE0"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACS54364.1"
FT                   /translation="MSKDFHDQGPRRVGQVKEVTSLANPIIKDIKALTNKKSREESGTF
FT                   LAEGLKLIIDAIELGWAIRTLVYAKAAKGKPLVEQMAAKTVASGGLVLEVSEKVIASIT
FT                   RRDNPQMVVGIFEQRWTPLKGIRLSDGETWVALDRVRDPGNLGTIIRTADAAGASGIIL
FT                   LGETTDPFSLETVRATMGSVFAVPVARATPEEFIAWRKSAGVSVVATHLAGAVDYRTID
FT                   YRKKPVVLLMGNEQSGLPEQLAREADALARIPQQGRADSLNLAVATAVMLFEARRHLLS
FT                   LAEGK"
     atgagcaagg acttccacga tcagggaccg cgcagggtcg ggcaggtgaa ggaagtcact        60
     tcgctcgcca atccgatcat caaggacatc aaggcgctga cgaacaagaa gtcgcgcgag       120
     gaaagcggta ctttcctggc cgaaggactg aaactcatca tcgatgcgat cgaactcggc       180
     tgggcgatcc gcacgctggt ctatgccaag gccgccaagg gcaagccgct ggtcgagcag       240
     atggcggcaa agaccgtcgc gtcgggcggg ctggtgcttg aggtcagcga aaaggtgatc       300
     gcctcgatca cccgccgcga caacccgcag atggtggtcg gcatcttcga gcagcgctgg       360
     acgccgctca aaggtatccg actgagcgac ggcgagacat gggtggcgct cgaccgggtg       420
     cgcgaccccg gcaatctcgg caccatcatc cgcacggccg atgcggcggg ggcttccggc       480
     atcatacttc tcggagaaac gactgatcct ttctcgctcg aaaccgtgcg ggccaccatg       540
     ggctcggtct ttgccgttcc ggtcgcgcgg gcgacgcccg aggaattcat cgcctggcgg       600
     aaatcggccg gcgtttccgt cgtcgcgacg catcttgccg gcgcggtcga ttaccggacg       660
     atcgactacc ggaaaaagcc cgtcgtgctc ctgatgggca acgaacaatc cggcctgccg       720
     gagcagctgg ccagggaggc cgacgcgctt gcccgcattc cgcagcaggg ccgcgccgat       780
     tcgctgaacc tcgccgtcgc caccgccgtc atgcttttcg aggcacgccg ccatctcctc       840
     tcacttgccg agggcaaatg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page