(data stored in ACNUC7421 zone)

EMBL: CP001622.PE520

CP001622.PE520       Location/Qualifiers
FT   CDS_pept        complement(549565..549972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54832"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L2"
FT                   /inference="similar to AA sequence:KEGG:Arad_3792"
FT                   /protein_id="ACS54832.1"
FT                   /translation="MIRRTRQIEQWALRILCAVALVFVGFAHQVPLAAAGEFDPAELAQ
FT                   YVLPDGTLPTLCVTTTDTSGQEQHDKAHSHGCEACRISASILLPAPTDIAGSAIHFAAT
FT                   VELPIRAEAFHRQLFPPNTGPRAPPSDPIPA"
     ttgatcagac ggacgagaca gatcgaacaa tgggcgctgc gcatcctgtg cgcggtcgca        60
     ctggtgttcg tcggcttcgc ccatcaggtt cccctcgcag cagccggcga attcgatccg       120
     gctgaactcg cgcaatatgt gcttccggac gggacgctgc cgacgctttg cgtcaccacg       180
     acagacacat ccggtcagga gcagcacgac aaggcgcatt cgcatggttg cgaagcctgc       240
     cggatcagcg cttccatcct cctgccggcg ccgacggaca tcgccggttc cgccatacac       300
     tttgcggcta cggttgaact gccgattcgg gccgaggcct tccatcgcca gcttttcccg       360
     cccaataccg gccctcgggc gcctccttcc gatccgatcc ctgcctga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page