(data stored in ACNUC7421 zone)

EMBL: CP001622.PE521

CP001622.PE521       Location/Qualifiers
FT   CDS_pept        complement(550064..551878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0528"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   sodium/hydrogen exchanger; TrkA-N domain protein; KEGG:
FT                   rec:RHECIAT_CH0000928 glutathione-regulated
FT                   potassium-efflux transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54833"
FT                   /db_xref="GOA:C6B2L3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L3"
FT                   /inference="protein motif:TFAM:TIGR00932"
FT                   /protein_id="ACS54833.1"
FT                   /translation="MSASNAFFSETILLLGGAVVAAPIFKKLGLGTVLGYLAAGIVIGP
FT                   VFHGITDGEQILAVAELGVVFLLFIIGLELKPTRLWQMRRDIFGLGAAQVVLTGLALTA
FT                   LAWFSQVLDWRGSIVAGFGLALSSTAFAMQILEGDGDVNTRYGQRSFSMLLFQDLAIVP
FT                   LLALITILDGGDKGSNAPLFDFAIAVGAVAAMIVMGRYLLTPLFQIIARTGAREAMIAA
FT                   ALFVVMGSASLMQLAGLSMAMGAFLSGVMLAESSYRHELEADIEPFRGVLLAIFFIAVG
FT                   LSLELDVLADNALFVIVAVPIVMAVKAIVIYGICRISGSSHDDAIRIAFLLPQGGEFGF
FT                   VLFTTAGAAGLMSTSTASLLVAIVTLSMALTPIGSALSKRLLNGDEQEELDEDFEGAGA
FT                   DVLMVGFSRFGQIAAQILLAGGRSVTVIDFSADRIRQASSFGFRIYFGDGARKDVLRSA
FT                   GIDRAKIVLVCTQKKEITDKVVELVQADYPHTRLYVRSYDRIHSIELRNKGIDYELRET
FT                   LESGLLFGRRTLEALGVSEVDAYEIGEDIRKRDEARLVLQVSEGLQAGRDMLFSHPVRP
FT                   EPLVKPKRAADPFEHDPLAGTADATADA"
     atgtcagcgt ccaatgcctt tttttccgaa acgatcctgc tgcttggcgg ggcggtggtc        60
     gccgcgccga tcttcaagaa actcgggctc ggcacggtgc tcggctatct cgccgccggc       120
     atcgtcatcg gcccggtctt ccacggcatc accgatggcg aacagatcct cgccgtcgcc       180
     gaactcggcg tcgtcttcct gctcttcatc atcggactgg agttgaaacc cacccgcctc       240
     tggcagatgc ggcgcgacat cttcggcctc ggcgcggcgc aggtggtgct gacggggcta       300
     gcgctgaccg cgcttgcctg gttttcccag gttctcgact ggcgcggcag catcgttgcc       360
     ggatttggcc tggcgctgtc ttcaaccgcc ttcgccatgc agatcctcga gggcgacggc       420
     gacgtcaata ccagatacgg gcaacgctcc ttttcgatgc tgctgttcca ggacctggcg       480
     atcgtgccgc tgctggcgct gatcaccatc ctcgacggcg gcgataaggg cagcaacgcg       540
     ccactgttcg atttcgctat cgccgtcggc gcggttgcgg cgatgatcgt catgggacgt       600
     tacctgctga cgccgctctt ccagatcatc gcccggaccg gcgcgcgcga agcaatgatc       660
     gcggctgccc tcttcgtcgt catgggatcg gcgagcttga tgcagctggc cgggctttcg       720
     atggcgatgg gcgccttcct atccggcgtg atgctggccg aatcctccta ccggcacgag       780
     ttggaggcag atatcgagcc gttccgcggc gtgctgctcg ctatcttctt tatcgccgtc       840
     ggcctgtcgc tggagctcga cgttctcgcc gacaacgcgc ttttcgtcat cgtcgccgtg       900
     ccgatcgtca tggccgtcaa ggcgatcgtc atctacggga tctgccggat ctccggctct       960
     tcgcacgacg atgcgatccg catcgctttc ctgctgccgc agggcggcga attcggcttc      1020
     gtgctgttta ccacggcggg tgcggccggg ctgatgtcga cgagcacagc ctcgctgctg      1080
     gtcgcgatcg tcacgctgtc catggcgctg acgccgatcg gctcggccct ttcgaagcgg      1140
     ctgctcaacg gcgacgaaca ggaggaactg gacgaggatt tcgagggcgc gggcgccgac      1200
     gtgctgatgg tcggcttctc gcgtttcggc cagatcgccg cccagatcct gcttgccggc      1260
     gggcgtagcg tcaccgtcat cgatttttcc gccgaccgca tccgccaggc ctcctccttc      1320
     ggcttccgca tctatttcgg cgacggcgcc cgcaaggacg tgctgcgctc ggccggcatc      1380
     gaccgggcga agatcgtgct ggtctgcacg cagaagaagg aaatcaccga caaggtggtg      1440
     gagctggtgc aggccgacta tccgcacacc cggctctacg tgcgctccta cgaccgcatc      1500
     cattcgatcg aactgcgcaa caagggtatc gactacgagc tgcgcgaaac gctggaatcg      1560
     ggcctactct tcggacggcg aacattggag gcgctcggcg tttccgaggt cgacgcctac      1620
     gaaatcggcg aggatatccg caagcgcgac gaggcacgcc tggtgctgca ggtgtccgaa      1680
     ggactgcagg ccgggcgcga catgctgttt tcccaccctg tccgccccga accgctggtc      1740
     aagccgaaac gcgccgccga tcccttcgag cacgatccgc tggccggaac cgccgatgcg      1800
     acggcggatg cctga                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page