(data stored in ACNUC7421 zone)

EMBL: CP001622.PE522

CP001622.PE522       Location/Qualifiers
FT   CDS_pept        551998..553344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0529"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   rec:RHECIAT_CH0000929 modulator of DNA gyrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54834"
FT                   /db_xref="GOA:C6B2L4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L4"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACS54834.1"
FT                   /translation="MSSEIDSSTLLSRASQLIDLARKAGADAADAVVVRSRSQSVSVRL
FT                   GKVEGTESSESDDFSLRVFIGKRVASVSANPGFDLQALAERAVAMAKVSPEDPFACLAD
FT                   EASLSRSYPDLQLLDTTEVSSEMLREAGLAAEAAALAVKGVTNSSGAGASAGMGGLVLA
FT                   TSHGFEGSYMASRFGHSVSVIAGEGTGMERDYDYDSRLYYAELDDPAEIGRRAGERVIK
FT                   RINPRQVPTGKDITVIFDPRVARGFVGHIAGAINGAAVARKSSFLRDKMGQQILKSGLS
FT                   ITDDPLIVRGPSSRPFDGEGVSGERLVMIEDGVLKHWFLSTSTARELDLETNGRGVRGG
FT                   TAVSPSSTNLALEPGDISPEDLIRSVGNGFYVTELIGHGVNMITGEYSRGATGFWIENG
FT                   ELTFPVSEVTIASNLKEMFMRLTLANDIDRKFGVAAPTFAIEGMTLAGR"
     atgtcctctg aaattgattc ctcgacactt ctttcccgcg caagtcaatt gatcgatctg        60
     gcaaggaagg caggggccga tgccgccgac gccgtcgtcg tccggtcgcg ctcgcaatcg       120
     gtgagcgtcc gcctcggcaa ggtcgagggc acggaatcct ccgaaagcga cgatttctcg       180
     ctgcgtgtct tcatcggcaa gcgtgtcgcc agcgtctcgg ccaatccggg cttcgatctt       240
     caggcgctgg ccgaacgcgc cgtcgccatg gccaaggttt ctccggaaga ccccttcgcc       300
     tgcctggcgg atgaggcgag tctttcgaga tcctatcccg acctgcaatt gctcgatacc       360
     accgaggtct cctccgagat gctgcgcgag gcgggtcttg ccgctgaagc agcagccctt       420
     gcggtcaagg gggttaccaa ttcctccggc gccggcgcgt cggccggcat gggcggcctc       480
     gttcttgcca cctcgcacgg tttcgaaggc agttacatgg cctcgcgttt cggccattcc       540
     gtcagcgtca tcgcaggtga aggcaccggc atggagcgcg actatgatta tgacagccgt       600
     ctctattatg ccgagctcga cgatcccgct gaaatcggcc gtcgcgccgg cgaacgggtg       660
     atcaaacgga tcaatccgcg ccaggtgccg accggcaagg acatcaccgt catcttcgat       720
     ccgcgtgtcg cccgcggctt cgtcggccat atcgccggtg cgatcaatgg tgccgccgtc       780
     gcccgcaagt ccagcttcct gcgcgacaag atgggtcagc agatcctgaa gtcaggcctg       840
     tcgatcaccg acgatccgct gatcgtgcgc ggcccttcct cgcggccctt cgacggcgag       900
     ggagtgtccg gcgagcggct ggtgatgatc gaggatggtg ttttgaagca ctggttcctc       960
     tcgacctcga ccgcgcgcga gctcgacctc gaaaccaacg gccgcggcgt gcgcggcggc      1020
     accgccgtct cgccttcttc caccaatctt gcgctggaac ccggcgacat ctcgccggag      1080
     gatctgatcc gcagcgttgg caacggtttt tatgtgaccg aattgatcgg ccacggcgtc      1140
     aacatgatca ccggcgaata cagccgcggc gccaccggct tctggatcga gaacggcgaa      1200
     ctcaccttcc cggtctccga ggtgacgatc gcctcgaacc tcaaggagat gttcatgcgc      1260
     ctgacgctgg caaacgacat cgatcgcaaa ttcggcgtcg cggctcccac gtttgccatc      1320
     gaaggcatga cgctcgcggg gcgctag                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page