(data stored in ACNUC7421 zone)

EMBL: CP001622.PE523

CP001622.PE523       Location/Qualifiers
FT   CDS_pept        553527..554336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0530"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG:
FT                   ret:RHE_CH00842 inositol monophosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54835"
FT                   /db_xref="GOA:C6B2L5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L5"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACS54835.1"
FT                   /translation="MSDMEKARWQSDLTLIADAAKEAGAVAFGFFNQSPEVWWKNEDRS
FT                   PVSAADFAANKTLETILRKARPDYGWLSEETDDDADRLSRETLFIIDPIDGTRAFLGGQ
FT                   KVWCVSVAVVHRGRPVAGVLYAPALEEFYEAVEGGVALKNGVPFTVSAAGPEEMSRLAI
FT                   GEDLLKTFPTEFRDRVTREKYIPSLAYRIAMVADGRLDGTFVKGNSHDWDLAAADLILV
FT                   CAGGGLVDIEGRPIVYNRAEVTHNVLCAAPTPRISEFLAAFAGRRDS"
     atgagcgaca tggagaaagc ccgctggcag agcgatctca cgctgatcgc cgatgctgcg        60
     aaagaggcgg gcgccgtcgc tttcggcttc ttcaaccagt cgcctgaggt ctggtggaag       120
     aacgaggacc gttcgcccgt cagcgccgcc gatttcgccg ccaacaagac gctcgagacc       180
     atcctgcgca aggcccggcc ggattatggc tggctgtcgg aagaaaccga cgacgatgcc       240
     gaccgccttt cacgcgaaac gctgttcatc atcgatccga tcgacggcac gcgcgccttc       300
     ctcggcgggc agaaggtctg gtgcgtcagc gtcgcggtgg ttcatcgtgg ccggccggtc       360
     gctggcgtgc tctatgcccc ggcgctcgag gagttctatg aggcggtcga gggcggcgtg       420
     gcgctgaaga acggcgtccc cttcaccgtc tcggcggccg gaccggaaga gatgagccgc       480
     cttgcaatcg gcgaagacct gctgaagacc tttccgacgg aattccgcga tcgggtgacg       540
     cgcgagaaat acattccctc gctggcctat cgcatcgcca tggtggcgga cggtcgtctc       600
     gacggcacct tcgtcaaggg caattcacat gattgggacc ttgccgctgc cgatctgatc       660
     ctcgtctgtg ccggcggcgg cctcgtcgac atcgaaggcc ggccgattgt ctacaatcgc       720
     gccgaagtca cccacaatgt cctctgcgcg gccccaacgc cccgcatcag tgagttcctc       780
     gcggcctttg cggggcgacg agacagttga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page