(data stored in ACNUC7421 zone)

EMBL: CP001622.PE524

CP001622.PE524       Location/Qualifiers
FT   CDS_pept        554398..554643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54836"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L6"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00843"
FT                   /protein_id="ACS54836.1"
FT                   /translation="MTDSGDKKQLLHLVFGGELESLDDVQFRDLQGLDIVGIFPDYATA
FT                   LTAWKSKAQQTVDNAHMRYFIVHMHRLLDPQEKPKG"
     atgactgact ccggtgacaa gaagcagctt ctgcatctcg tttttggcgg cgaactggaa        60
     agcctcgatg acgtccagtt ccgtgatctg cagggtctcg atatcgtcgg cattttcccg       120
     gattatgcca cggcgctgac ggcctggaag tcgaaggcgc agcagacggt cgacaatgcg       180
     catatgcgct acttcatcgt ccacatgcat cgtttgctcg atccgcagga aaagcccaag       240
     ggctga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page