(data stored in ACNUC7421 zone)

EMBL: CP001622.PE525

CP001622.PE525       Location/Qualifiers
FT   CDS_pept        554817..556136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0532"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: rec:RHECIAT_CH0000932
FT                   3-deoxy-D-manno-octulosonic acid transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54837"
FT                   /db_xref="GOA:C6B2L7"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L7"
FT                   /inference="protein motif:PFAM:PF04413"
FT                   /protein_id="ACS54837.1"
FT                   /translation="MSSRMARFGLNAYRLAGTVASPVVGLYITYRTAKGKEDRARRLER
FT                   FGYPSANRPQGPLIWFHAASVGETNAVIPLIREIRRRDIHVILTTGTITSAKLAAERLG
FT                   LEAIHQYVPLDLKPSVSRFLDYWQPDCAIIAESEIWPATVLELGRRRIPQILINARMSD
FT                   RSFARWRRRPAIAEALFENLALVIAQSDVDAERFRDLGAVPVITSGNLKVDTDAPPYDS
FT                   AVFARYKKQIGERKTWAAISTFDGEENAAAIVHRALRERDRQLTIIVPRHPERSDEIEA
FT                   ALVKQGLKVARRTRDDVLSADVDIFLGDTIGEMGLYLRLTEIAFVGRSLFAEGGQNPLE
FT                   PAMLGCAILSGGHVQNFRDAYQKLARSGSARMVRDTEMLAKGVHYLLINDDARRNMIEA
FT                   GITAVHEMRGALTATVKGLEPYINPLTVKARLLPKAVAQV"
     atgagttccc ggatggcgcg gttcggtctg aacgcatacc gtctggcggg aaccgtggcc        60
     tctccagtcg tcggcctcta tatcacctac cgcacggcca agggcaagga agaccgggcc       120
     cgccgcctgg agcgcttcgg ctatccgagc gccaaccggc cgcagggccc gctcatctgg       180
     tttcacgccg caagcgtcgg tgaaaccaac gccgtcatcc cgctgatccg cgaaatccgc       240
     cgccgcgaca tccatgtcat cctgacgacc ggcaccatca cctcggccaa gctcgccgcc       300
     gagcgcctcg gcctggaagc gatccatcaa tatgtgccgc tcgacctgaa gccctccgtc       360
     agccgcttcc tcgattattg gcagcccgat tgcgccatca tcgccgaatc cgagatctgg       420
     ccggcaacgg tgctggaact cggccgccgc cgcattccgc agatcctgat caatgcccgc       480
     atgtcggacc gctcctttgc ccgctggcgc cgccgcccgg cgatcgccga agccttgttc       540
     gagaatcttg ccctcgtcat cgcccagtcg gatgtcgatg ccgaacgttt ccgcgatctc       600
     ggcgctgtgc ccgtcatcac ctcgggcaat ctgaaggtcg ataccgacgc accgccctat       660
     gacagcgctg tcttcgcccg ctacaagaag cagatcggcg agcgcaagac ctgggcggcg       720
     atctcgacct tcgacggaga ggagaacgct gccgccatcg ttcaccgggc gctcagggag       780
     cgcgaccgcc agttgacgat tattgtgccg cgccatcccg agcgcagcga cgagatcgag       840
     gcggccctcg tcaagcaggg gctgaaggtc gcccgccgca cccgcgacga tgtcttgtcc       900
     gccgatgtcg atattttcct cggcgatacg atcggcgaaa tgggtcttta tctccgtctg       960
     acggaaatcg ccttcgtcgg ccgctcgctc tttgccgaag gcggccagaa cccgctggag      1020
     ccagccatgc tcggctgcgc cattctctcc ggcggccatg tgcagaattt ccgcgatgcc      1080
     tatcagaagc ttgcccgcag cggcagcgcc cgcatggtgc gcgatactga aatgctggcc      1140
     aagggtgtgc attatctgct gatcaacgac gacgcccgcc gcaacatgat cgaggccggc      1200
     atcaccgccg tgcacgagat gcgcggcgcg ctgacggcaa cggtaaaggg gctggaaccc      1260
     tatatcaatc cgctgacggt gaaggcgcgg ctgctgccca aggccgtggc ccaggtctga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page