(data stored in ACNUC7421 zone)

EMBL: CP001622.PE526

CP001622.PE526       Location/Qualifiers
FT   CDS_pept        556146..556868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0533"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ret:RHE_CH00845 phosphoglycolate
FT                   phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54838"
FT                   /db_xref="GOA:C6B2L8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L8"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACS54838.1"
FT                   /translation="MSAVASIKGILFDKDGTLLDYDESWLPVNRELARIAARGDELLAN
FT                   RLLSACGMDPVTGHIVPDSLLAAGNTRQIASGLVAAGSMVDVDELTVRLDDLFSSAAEF
FT                   SVPVTDLAGFFERLHRRGFKLGVASSDNERSIRQTAERFGFARYIDYIAGYDSGFGVKP
FT                   EPGMVLGFCAATGLLPEEVAMVGDNNHDLHMGLNAGTGLRIAVLTGTGSRETLAAAADH
FT                   VLDDITAIETLLPDLQPA"
     atgtcggcag tggcctctat caaaggcatt ctcttcgaca aggacggcac gctgctcgac        60
     tatgacgaga gctggctgcc ggtcaaccgc gagcttgccc gcatcgccgc cagaggggat       120
     gagcttctcg ccaaccggct gctgtcggcc tgcggcatgg atccggtgac cggccatatc       180
     gttcccgaca gcctgcttgc cgccggcaat acccgtcaga tcgcctcagg ccttgttgcc       240
     gcgggttcga tggtggatgt cgacgaactg acggtccgcc tcgacgacct gttttccagt       300
     gccgccgaat tttccgtgcc ggtgaccgac ctcgccggct tcttcgagcg gctgcatcgg       360
     cgcggcttca agctcggtgt cgcctccagc gacaatgagc ggtcgatccg ccagacggcg       420
     gaacgtttcg gttttgcccg ctatatcgat tacatcgccg gctacgacag cggtttcggc       480
     gtcaagccgg agcccggcat ggtgctcggc ttctgcgctg cgaccggtct tttgcctgaa       540
     gaggtcgcca tggtcggcga taacaatcac gatctgcaca tgggtctgaa tgccggcacg       600
     ggtctcagga tcgcggtgct gaccggcacc ggttcgcggg agacgcttgc cgccgcggcc       660
     gatcatgtgc tcgacgatat caccgccatc gagacgctgc tgcccgactt gcagccggcc       720
     tga                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page