(data stored in ACNUC7421 zone)

EMBL: CP001622.PE527

CP001622.PE527       Location/Qualifiers
FT   CDS_pept        557052..558095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0534"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: ret:RHE_CH00846 tetraacyldisaccharide
FT                   4'-kinase; TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54839"
FT                   /db_xref="GOA:C6B2L9"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2L9"
FT                   /inference="protein motif:TFAM:TIGR00682"
FT                   /protein_id="ACS54839.1"
FT                   /translation="MISEAPPFWWRKADWRAWLLLPLSFLYGRIASHRMAHARRASVPI
FT                   PVICVGNFTVGGAGKTPTALTIARAAKAKGLKPGFLSRGYGGSLDVTTVVDPDHHRAIA
FT                   VGDEPLLLAQEALTVISRRRVEGAARLVAEGADLIIMDDGFQSARLAIDYALLVIDATR
FT                   GLGNGHIVPGGPVRAPIRQQLRSATALLKVGGGNAADRIVRMAARAAKPYFTASLKVRG
FT                   DNTLAGTKVLAFAGIADPAKFFRTVESRGAEIVVAKSFGDHEHLTEEEIDDILTTAERQ
FT                   GLLIVTTSKDFVRLSGHQGKAARLVEKSRVIEVDMVFEDHLAPSLIIDRAIVACRERRL
FT                   REMKAGA"
     atgatatccg aagcgccacc gttctggtgg aggaaagccg attggcgggc ctggctgctg        60
     ctgccgcttt cttttctcta tggccgtatc gccagccacc gcatggccca tgcgcgccgc       120
     gcttccgttc ccatcccggt catctgcgtc ggcaatttca ccgtcggcgg cgccggcaag       180
     acgccgacgg cgctgacgat cgctcgcgcc gccaaggcga aggggctgaa gcccggcttt       240
     ctcagcaggg gttacggcgg ctcgctcgat gtgaccaccg tggtcgatcc cgatcatcac       300
     cgggcgattg ccgtcggcga cgagccgttg ttgcttgccc aggaagcgct gacggtgatt       360
     tcgcgccggc gcgtcgaagg agctgcacgg ctggtggcgg agggcgccga tctcatcatc       420
     atggatgacg gtttccagag tgcccggctg gcgatcgact atgccctgct cgtcatcgac       480
     gcgacgcgcg gcctcggcaa cggccatatc gtgccgggtg gcccggtccg cgcgccgatc       540
     cgccagcagc tgcggtccgc gaccgctctg ctgaaggttg gcggcggcaa tgccgccgac       600
     aggatcgtcc gcatggcggc gcgcgcggca aagccctatt tcaccgcatc gctgaaagtc       660
     cggggcgaca acacgctggc cggcaccaag gtgctcgcct ttgccggcat cgccgatccc       720
     gccaaattct tccgcacggt cgaatcccgc ggcgccgaga tcgtcgtcgc caagtccttc       780
     ggcgatcacg agcacctgac cgaggaggag atcgacgaca tcctgacaac cgccgagcgt       840
     caaggtctct tgatcgtcac cacctccaag gatttcgtcc gcctgtccgg ccatcagggc       900
     aaggcggcac ggctcgtcga aaagagccgg gtgatcgagg tcgacatggt cttcgaggat       960
     cacctcgccc ccagcctgat catcgaccgg gcgatcgtcg cctgccgcga gcggcggctg      1020
     cgggaaatga aggctggggc ttag                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page