(data stored in ACNUC7421 zone)

EMBL: CP001622.PE528

CP001622.PE528       Location/Qualifiers
FT   CDS_pept        complement(558179..559084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0535"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sil:SPO2668 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54840"
FT                   /db_xref="GOA:C6B2M0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B2M0"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS54840.1"
FT                   /translation="MELGWLEDFMELAAVRNFSTAAAARHVTQPAFSRRIRALENWIGA
FT                   ALIDRSSYPVRLTNAGETFLESSRELMREIYRVRDECRQQARAGIEVLTFSALHTIALS
FT                   IFPDLLTSVEQRTGPFITRMHATDFYDCVESLALGRCDIAFCYSHEFGPPVLQTGQFSS
FT                   KVIRIDPFHLVSKADQRGNPVIDLATWPGNEDMPLVAYSSDCFLGKVQTQLMLDMQKTG
FT                   RSFRVTYENSMSESVKRMILAGKGIGWLPESSATREIERNELCIVDARQAEVTLNVLAI
FT                   RKQGSGSAALERFWSNLQGL"
     atggaactcg gttggctaga agacttcatg gaactcgcgg ccgtgcggaa cttttctacc        60
     gccgcagcgg cccgacatgt gacgcagccc gccttcagcc gcagaataag ggcgctggaa       120
     aactggatcg gcgccgcgct gatcgatcgc agctcctatc cggtcaggct aacgaacgcc       180
     ggggagacgt ttctcgagtc gagccgtgag ttgatgcgcg aaatctaccg cgtccgcgat       240
     gaatgccggc aacaggcacg cgccggcatc gaggtgctca ccttcagcgc gctgcacacc       300
     atcgctctta gtatctttcc cgatcttctt acgagcgtcg aacaacgcac cggtcccttc       360
     ataacccgga tgcatgcgac ggacttctac gactgcgtag aatcgcttgc gctcggccgc       420
     tgcgacatcg ccttttgcta ttcccacgag ttcgggccac cggtcctgca gaccgggcag       480
     ttctcctcga aggttatcag aatcgatcct ttccacctcg tcagcaaggc agatcaacga       540
     ggaaacccgg tcatcgactt ggcaacttgg cccggaaacg aagatatgcc tctcgtcgcc       600
     tattcatccg actgctttct cggaaaagtg caaactcagc tcatgctcga catgcagaag       660
     acagggcgga gctttcgagt aacctatgaa aactcgatgt cggagtcggt caagcgcatg       720
     attctcgcgg ggaaaggcat cggctggctg ccggaaagct ctgcgacccg cgagatagag       780
     cggaacgaac tctgtatcgt cgacgcgcga caggctgagg tcaccctgaa cgtcctcgct       840
     atccgcaagc agggcagcgg ctcagccgcc ctcgaacgct tctggtcaaa tctgcagggt       900
     ttgtga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page